1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-17
  5. IL-25/IL-17E
  6. IL-25/IL-17E Protein, Mouse (HEK293, N-His)

Interleukin-25 (IL-25), also known as IL-17E, belongs to the IL-17 cytokine family. IL-25 activates NF-κB, MAPKs and JAK/STAT signaling pathways. IL-25 exerts singal transduction through receptors composed of IL17RA and IL17RB. IL-25/IL-17E Protein, Mouse (HEK293, N-His) is the recombinant mouse-derived IL-25/IL-17E protein, expressed by HEK293 , with N-His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis   Apply now
Muestra gratis   Apply now
2 μg En stock
10 μg En stock
50 μg Obtener un presupuesto
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

Interleukin-25 (IL-25), also known as IL-17E, belongs to the IL-17 cytokine family. IL-25 activates NF-κB, MAPKs and JAK/STAT signaling pathways[1]. IL-25 exerts singal transduction through receptors composed of IL17RA and IL17RB[7]. IL-25/IL-17E Protein, Mouse (HEK293, N-His) is the recombinant mouse-derived IL-25/IL-17E protein, expressed by HEK293 , with N-His labeled tag.

Background

and is also produced by various immune cells such as CD8+ T cells, mast cells, macrophages, dendritic cells (DCs), eosinophils, basophils, group 2 innate lymphoid cells (ILC2s), epithelial and endothelial cells[1][2][3][4][5][6]. IL-25 exerts singal transduction through receptors composed of IL17RA and IL17RB[7]. IL-25 induces the expression of IL-4, IL-5, IL-13, TGF-β, and G-CSF[8][9]. IL-25 can stimulate cell proliferation, inhibition of apoptosis, production of inflammatory cytokines and chemokines, modulation of cell-cell adhesion, and cell motility in nonimmune cells[10][11][12][13]. IL-25 activates NF-κB, MAPKs and JAK/STATs signaling pathways[1][14]. The sequence homology of IL-25 between human and mouse, mouse and rat is 78.88% and 91.12% respectively.

Actividad biológica

Measured by its ability to induce CXCL1 secretion in HT-29 human colon adenocarcinoma cells. The ED50 for this effect is 0.854-0.8788 ng/mL, corresponding to a specific activity is 1.138×106-1.171×106 U/mg.

  • Measured by its ability to induce CXCL1 secretion in HT‑29 human colon adenocarcinoma cells. The ED50 for this effect is 0.854 ng/mL, Corresponding to a specific activity is 1.171×106 U/mg.
Species

Mouse

Source

HEK293

Tag

N-6*His

Accession

Q8VHH8 (V17-A169)

Gene ID

140806

Molecular Construction
N-term
His
IL-17E (V17-A169)
Accession # Q8VHH8
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interleukin-25; IL-25; Interleukin-17E; IL-17E
AA Sequence

VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA

Predicted Molecular Mass
17.5 kDa
Peso molecular

Approximately 20-28 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Pureza
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.2, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

IL-25/IL-17E Protein, Mouse (HEK293, N-His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
IL-25/IL-17E Protein, Mouse (HEK293, N-His)
Cat. No.:
HY-P73198A
Cantidad:
MCE Japan Authorized Agent: