IL-25/IL-17E Protein, Mouse (HEK293, N-His)

Interleukin-25 (IL-25), also known as IL-17E, belongs to the IL-17 cytokine family. IL-25 activates NF-κB, MAPKs and JAK/STAT signaling pathways^[1]. IL-25 exerts singal transduction through receptors composed of IL17RA and IL17RB^[7]. IL-25/IL-17E Protein, Mouse (HEK293, N-His) is the recombinant mouse-derived IL-25/IL-17E protein, expressed by HEK293 , with N-His labeled tag.

and is also produced by various immune cells such as CD8⁺ T cells, mast cells, macrophages, dendritic cells (DCs), eosinophils, basophils, group 2 innate lymphoid cells (ILC2s), epithelial and endothelial cells^{[1][2][3][4][5][6]}. IL-25 exerts singal transduction through receptors composed of IL17RA and IL17RB^[7]. IL-25 induces the expression of IL-4, IL-5, IL-13, TGF-β, and G-CSF^[8][9]. IL-25 can stimulate cell proliferation, inhibition of apoptosis, production of inflammatory cytokines and chemokines, modulation of cell-cell adhesion, and cell motility in nonimmune cells^{[10][11][12][13]}. IL-25 activates NF-κB, MAPKs and JAK/STATs signaling pathways^[1][14]. The sequence homology of IL-25 between human and mouse, mouse and rat is 78.88% and 91.12% respectively.

Measured by its ability to induce CXCL1 secretion in HT-29 human colon adenocarcinoma cells. The ED₅₀ for this effect is 0.854-0.8788 ng/mL, corresponding to a specific activity is 1.138×10⁶-1.171×10⁶ U/mg.

• 
  Measured by its ability to induce CXCL1 secretion in HT‑29 human colon adenocarcinoma cells. The ED₅₀ for this effect is 0.854 ng/mL, Corresponding to a specific activity is 1.171×10⁶ U/mg.

Mouse

HEK293

N-6*His

Q8VHH8 (V17-A169)

140806

Full Length of Mature Protein

VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA

Approximately 20-28 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.2, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.