IL-32 alpha Protein, Human (HEK293, His)
Based on 1 Customer Validation
IL-32 protein is a member of the cytokine family whose expression increases following T cell activation or IL-2-induced NK cell activation. It plays a key role in inducing macrophages to produce TNFα, which contributes to the inflammatory response. IL-32 alphaProtein, Human (HEK293, His) is the recombinant human-derived IL-32 alpha protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-32 protein is a member of the cytokine family whose expression increases following T cell activation or IL-2-induced NK cell activation. It plays a key role in inducing macrophages to produce TNFα, which contributes to the inflammatory response. IL-32 alphaProtein, Human (HEK293, His) is the recombinant human-derived IL-32 alpha protein, expressed by HEK293 , with C-His labeled tag.
Background
IL-32 Protein, a member of the cytokine family, is characterized by features such as a tyrosine sulfation site, three potential N-myristoylation sites, multiple putative phosphorylation sites, and an RGD cell-attachment sequence. Its expression is notably increased following the activation of T-cells by mitogens or the activation of NK cells by IL-2. IL-32 plays a pivotal role in inducing the production of TNFalpha from macrophage cells, implicating its involvement in inflammatory responses. The gene exhibits alternative transcriptional splice variants, giving rise to different isoforms with distinct functional characteristics. IL-32 demonstrates broad expression across various tissues, with substantial levels observed in the small intestine (RPKM 122.1), spleen (RPKM 121.0), and 22 other tissues, underscoring its diverse roles and potential contributions to immune modulation and tissue-specific functions.
Verified Bioactivity
Measured by its ability to induce TNF-alpha secretion by RAW 264.7 mouse monocyte/macrophage cells. The ED50 for this effect is 0.5-3 μg/mL in the presence of 5 μg/mL MDP.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P24001-4/NP_001012651 (M1-K131)
-
Molecular Construction
-
N-term
-
IL-32 (M1-K131)
Accession # NP_001012651 -
6*His
-
C-term
-
-
Protein Length
Full Length of Isoform-4
-
Synonyms
IL32; Interleukin-32; Interleukin 32; Interleukin-32 Small; TAIF; Interleukin-32 Eta; NK4; IL-32alpha; TAIFb; IL-32delta; TAIFd; IL-32gamma; Tumor Necrosis Factor Alpha-Inducing Factor; IL-32beta; Natural Killer Cell Transcript 4; TAIFa; Natural Killer Ce
-
AA Sequence
MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKSYGAPRGDKEELTPQKCSEPQSSK
-
Predicted Molecular Mass
15.7 kDa
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% tween 80.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
