IL-3R alpha/CD123 Protein, Human (Biotinylated, HEK293, Avi)
FITC-tagged IL-3R α/CD123 is a cell surface receptor for IL3 expressed on hematopoietic progenitor cells, monocytes, and B lymphocytes, regulating their production and differentiation. IL-3R alpha/CD123, Human (Biotinylated, HEK293, Avi) is the recombinant human-derived IL-3R alpha/CD123 protein, expressed by HEK293, with C-Avi/C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FITC-tagged IL-3R α/CD123 is a cell surface receptor for IL3 expressed on hematopoietic progenitor cells, monocytes, and B lymphocytes, regulating their production and differentiation. IL-3R alpha/CD123, Human (Biotinylated, HEK293, Avi) is the recombinant human-derived IL-3R alpha/CD123 protein, expressed by HEK293, with C-Avi/C-hFc labeled tag.
Background
IL-3R alpha/CD123 Protein serves as a cell surface receptor for IL3 and is expressed on hematopoietic progenitor cells, monocytes, and B-lymphocytes, exerting control over the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells. Upon ligand stimulation, it rapidly undergoes heterodimerization with IL3RB, leading to the phosphorylation and activation of effector proteins, including JAK2 and PI3K. These activated pathways play a crucial role in signaling cell proliferation and differentiation. JAK2 activation further initiates a STAT5-mediated transcriptional program, contributing to the regulation of cellular functions. The receptor interacts with its ligand, IL3, and forms a heterodimer consisting of an alpha and a beta subunit. Notably, the beta subunit is shared among the receptors for IL3, IL5, and GM-CSF.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi
-
Accession
P26951-1 (T19-R305)
-
Gene ID3563
-
Molecular Construction
-
N-term
-
IL-3Rα (T19-R305)
Accession # P26951-1 -
Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
IL3RA; IL-3R-Alpha; Interleukin 3 Receptor Subunit Alpha; IL3R; CD123; HIL-3Ra; Interleukin 3 Receptor, Alpha (Low Affinity); IL3RAY; Interleukin-3 Receptor Subunit Alpha; IL-3RA; IL-3 Receptor Subunit Alpha; IL3RX; IL-3R Subunit Alpha; IL3RY; CD123 Antig
-
AA Sequence
TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWR
-
Predicted Molecular Mass
35.3 kDa
-
Molecular Weight
Approximately 53-63 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
