Copy Link Print Information

IL-4 Protein, Rhesus macaque

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

IL-4 protein actively engages in B-cell activation, serving as a costimulator for DNA synthesis, inducing class II MHC molecule expression, and enhancing IgE and IgG1 secretion. It regulates CD23 expression on lymphocytes and monocytes, positively influences IL31RA expression in macrophages, and induces autophagy in dendritic cells through mTORC1 signaling interference and RUFY4 induction. IL-4 Protein, Rhesus macaque is the recombinant Rhesus Macaque-derived IL-4 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Rhesus Macaque
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-4 Protein, Rhesus macaque
  • Experimental Validation Results for IL-4 Protein, Rhesus macaque
  • IL-4 Protein, Rhesus macaque Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-4 protein actively engages in B-cell activation, serving as a costimulator for DNA synthesis, inducing class II MHC molecule expression, and enhancing IgE and IgG1 secretion. It regulates CD23 expression on lymphocytes and monocytes, positively influences IL31RA expression in macrophages, and induces autophagy in dendritic cells through mTORC1 signaling interference and RUFY4 induction. IL-4 Protein, Rhesus macaque is the recombinant Rhesus Macaque-derived IL-4 protein, expressed by E. coli , with tag free.

Background

IL-4 protein actively participates in various B-cell activation processes and other cell types, acting as a costimulator of DNA synthesis. Moreover, it induces the expression of class II MHC molecules on resting B-cells and enhances the secretion and cell surface expression of IgE and IgG1. IL-4 also plays a regulatory role in the expression of the low affinity Fc receptor for IgE (CD23) on lymphocytes and monocytes. Additionally, it positively regulates IL31RA expression in macrophages and stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and inducing RUFY4.

Verified Bioactivity

The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 1.0 ng/mL, corresponding to a specific activity of >1.0x106 IU/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 0.2042 ng/mL, corresponding to a specific activity is 4.897×106 U/mg

Technical Parameters

  • Species Rhesus Macaque
  • Source E. coli
  • Tag Tag Free
  • Accession

    P51492 (H25-S153)

  • Gene ID
    574281  [NCBI]
  • Molecular Construction
    • N-term
    • IL-4 (H25-S153)
      Accession # P51492
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL4; B_cell Stimulatory Factor 1; Interleukin 4; B-Cell Stimulatory Factor 1; IL-4; B Cell Growth Factor 1; Lymphocyte Stimulatory Factor 1; Binetrakin; Interleukin-4; Pitrakinra; BCGF-1; MGC79402; BCGF1; BSF-1; BSF1

  • AA Sequence

    HNCHIALREIIETLNSLTEQKTLCTKLTITDILAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLEDFLERLKTIMREKYSKCSS

  • Predicted Molecular Mass

    14.9 kDa

  • Molecular Weight

    Approximately 14-18 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.2 μm solution of 2xPBS, 5 % Trehalose, pH 7.4.
2.Lyophilized from a 0.2 μm solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 0.2042 ng/mL, corresponding to a specific activity is 4.897×106 U/mg

  • IL-4 Protein, Rhesus macaque Product Image
    1/16
  • Experimental Validation Results for IL-4 Protein, Rhesus macaque
  • Experimental Validation Results for IL-4 Protein, Rhesus macaque
  • IL-4 Protein, Rhesus macaque Product Image