IL-4 Protein, Rhesus macaque

IL-4 protein actively engages in B-cell activation, serving as a costimulator for DNA synthesis, inducing class II MHC molecule expression, and enhancing IgE and IgG1 secretion. It regulates CD23 expression on lymphocytes and monocytes, positively influences IL31RA expression in macrophages, and induces autophagy in dendritic cells through mTORC1 signaling interference and RUFY4 induction. IL-4 Protein, Rhesus macaque is the recombinant Rhesus Macaque-derived IL-4 protein, expressed by E. coli , with tag free. The total length of IL-4 Protein, Rhesus macaque is 129 a.a., with molecular weight of ~14.9 kDa.

IL-4 protein actively participates in various B-cell activation processes and other cell types, acting as a costimulator of DNA synthesis. Moreover, it induces the expression of class II MHC molecules on resting B-cells and enhances the secretion and cell surface expression of IgE and IgG1. IL-4 also plays a regulatory role in the expression of the low affinity Fc receptor for IgE (CD23) on lymphocytes and monocytes. Additionally, it positively regulates IL31RA expression in macrophages and stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and inducing RUFY4.

Rhesus Macaque

E. coli

Tag Free

P51492 (H25-153S)

574281  [NCBI]

HNCHIALREIIETLNSLTEQKTLCTKLTITDILAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLEDFLERLKTIMREKYSKCSS

Approximately 14.9 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.