IL-9 Protein, Mouse (sf9, His)
Based on 1 Customer Validation
IL-9 is secreted by T helper 2 lymphocytes, mast cells, and NKT cells and plays an important role in antiparasitic immune responses, affecting intestinal permeability, adaptive immunity, and T cell subset differentiation.It promotes TH17 cell and mast cell proliferation through IL9R and IL2RG receptor activation, triggering JAK1 and JAK3 kinases and subsequent STAT-mediated transcription.IL-9 Protein, Mouse (sf9, His) is the recombinant mouse-derived IL-9 protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Mouse
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
IL-9 is secreted by T helper 2 lymphocytes, mast cells, and NKT cells and plays an important role in antiparasitic immune responses, affecting intestinal permeability, adaptive immunity, and T cell subset differentiation.It promotes TH17 cell and mast cell proliferation through IL9R and IL2RG receptor activation, triggering JAK1 and JAK3 kinases and subsequent STAT-mediated transcription.IL-9 Protein, Mouse (sf9, His) is the recombinant mouse-derived IL-9 protein, expressed by Sf9 insect cells , with C-His labeled tag.
IL-9, a multifunctional cytokine primarily secreted by T-helper 2 lymphocytes and also by mast cells or NKT cells, assumes crucial roles in the immune response against parasites. Beyond its anti-parasitic function, IL-9 influences intestinal epithelial permeability and adaptive immunity. It plays a pivotal role in inducing the differentiation of specific T-cell subsets, such as IL-17-producing helper T-cells (TH17), and promotes the proliferation and differentiation of mast cells. Mechanistically, IL-9 exerts its diverse biological effects through a receptor comprised of the IL9R subunit and the signal transducing subunit IL2RG. Stimulation of this receptor leads to rapid activation of JAK1 and JAK3 kinase activities, initiating STAT1, STAT3, and STAT5-mediated transcriptional programs. The induction of differentiation genes appears to be mediated by STAT1 alone, while the protection of cells from apoptosis depends on the concerted actions of STAT3 and STAT5. IL-9 interacts directly with IL9R and IL2RG, orchestrating a sophisticated network of interactions to modulate immune responses and cellular processes.
Measured in a cell proliferation assay using MC/9 mouse mast cells and the ED50 is typically 0.2-2 ng/mL.
Technical Parameters
-
Species Mouse
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
P15247 (Q19-P144)
-
Molecular Construction
-
N-term
-
IL-9 (Q19-P144)
Accession # P15247 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL9; Homolog Of Mouse T Cell And Mast Cell Growth Factor 40; Interleukin 9; P40 T-Cell And Mast Cell Growth Factor; IL-9; Interleukin-9; T-Cell Growth Factor P40; P40 Cytokine; HP40; Cytokine P40; P40
-
AA Sequence
QRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP
-
Predicted Molecular Mass
15.6 kDa
-
Molecular Weight
Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 150 mM NaCl, pH 8.0, 10% Glycerol, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (260 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
