KAT6A Protein, Human (Biotinylated, Avi)

Customer Review

Based on 1 Customer Validation

KAT6A Protein, Human (Biotinylated, Avi) is the recombinant human-derived KAT6A, expressed by E. coli , with Avi labeled tag. ,

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

KAT6A Protein, Human (Biotinylated, Avi) is the recombinant human-derived KAT6A, expressed by E. coli , with Avi labeled tag. ,

Background

KAT6A is a histone acetyltransferase that acetylates lysine residues in histone H3 and histone H4 (in vitro). It is a component of the MOZ/MORF complex, which exhibits histone H3 acetyltransferase activity. KAT6A may function as a transcriptional coactivator for RUNX1 and RUNX2. Additionally, it acetylates p53/TP53 at Lys-120 and Lys-382, regulating its transcriptional activity through association with PML.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-Avi
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    KAT6A; Histone Acetyltransferase KAT6A; Prev. MYST3; Zinc Finger Protein 220; Prev. RUNXBP2; ZC2HC6A; Prev. ZNF220; MYST-3; MOZ; Runt-Related Transcription Factor-Binding Protein 2; Monocytic Leukemia Zinc Finger Protein; Histone Acetyltransferase MYST3;

  • AA Sequence

    GVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCEFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLTGICPQDITSTLHHLRMLDFRSDQFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTPVI

  • Predicted Molecular Mass

    35.6 kDa

  • Structure/Form

    Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 500 mM NaCl, 20% glycerol, 1 mM DTT.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00