KAT6A Protein, Human (Biotinylated, Avi)
Based on 1 Customer Validation
KAT6A Protein, Human (Biotinylated, Avi) is the recombinant human-derived KAT6A, expressed by E. coli , with Avi labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
KAT6A Protein, Human (Biotinylated, Avi) is the recombinant human-derived KAT6A, expressed by E. coli , with Avi labeled tag. ,
KAT6A is a histone acetyltransferase that acetylates lysine residues in histone H3 and histone H4 (in vitro). It is a component of the MOZ/MORF complex, which exhibits histone H3 acetyltransferase activity. KAT6A may function as a transcriptional coactivator for RUNX1 and RUNX2. Additionally, it acetylates p53/TP53 at Lys-120 and Lys-382, regulating its transcriptional activity through association with PML.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-Avi
-
Accession
Q92794 (G497-I780)
-
Gene ID7994
-
Protein Length
Partial
-
Synonyms
KAT6A; Histone Acetyltransferase KAT6A; Prev. MYST3; Zinc Finger Protein 220; Prev. RUNXBP2; ZC2HC6A; Prev. ZNF220; MYST-3; MOZ; Runt-Related Transcription Factor-Binding Protein 2; Monocytic Leukemia Zinc Finger Protein; Histone Acetyltransferase MYST3;
-
AA Sequence
GVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCEFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLTGICPQDITSTLHHLRMLDFRSDQFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTPVI
-
Predicted Molecular Mass
35.6 kDa
-
Structure/Form
Approximately 35 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 500 mM NaCl, 20% glycerol, 1 mM DTT.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
