KIR2DL5/CD158f Protein, Human (HEK293, His-Avi)
Based on 1 Customer Validation
KIR2DL5/CD158f, present on NK cells, acts as a receptor for HLA-C alleles. Its inhibitory function finely tunes NK cell activity, preventing cell lysis by interacting with specific HLA-C molecules. This dynamic engagement contributes to the nuanced balance of inhibitory signals in the immune system, regulating NK cell responses to potential targets. KIR2DL5/CD158f Protein, Human (HEK293, His-Avi) is the recombinant human-derived KIR2DL5/CD158f protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
KIR2DL5/CD158f, present on NK cells, acts as a receptor for HLA-C alleles. Its inhibitory function finely tunes NK cell activity, preventing cell lysis by interacting with specific HLA-C molecules. This dynamic engagement contributes to the nuanced balance of inhibitory signals in the immune system, regulating NK cell responses to potential targets. KIR2DL5/CD158f Protein, Human (HEK293, His-Avi) is the recombinant human-derived KIR2DL5/CD158f protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
KIR2DL5/CD158f, expressed on natural killer (NK) cells, functions as a receptor for HLA-C alleles. This receptor operates in an inhibitory manner, regulating NK cell activity to prevent cell lysis. By interacting with specific HLA-C molecules, KIR2DL5 contributes to the delicate balance of inhibitory signals in the immune system, fine-tuning the response of NK cells to potential targets.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
Q8N109 (H22-H240)
-
Gene ID57292 [NCBI]
-
Molecular Construction
-
N-term
-
CD158f (H22-H240)
Accession # Q8N109 -
8*His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
KIR2DL5A; Killer Cell Immunoglobulin-Like Receptor, Two Domains, Long Cytoplasmic Tail, 5; Killer Cell Immunoglobulin Like Receptor, Two Ig Domains And Long Cytoplasmic Tail 5A; Killer Cell Immunoglobulin-Like Receptor KIR2DL5A; KIR2DL5; Killer Cell Immun
-
AA Sequence
HEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVNGTFQADFPLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLH
-
Predicted Molecular Mass
26.3 kDa
-
Molecular Weight
Approximately 45-52 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
