KIR3DL3/CD158z Protein, Human (HEK293, His-Avi)
KIR3DL3/CD158z, on natural killer cells, potentially inhibits NK cell activity, contributing to the prevention of cell lysis. This regulatory role underscores the significance of KIR3DL3 in modulating NK cell functions and maintaining immune homeostasis. KIR3DL3/CD158z Protein, Human (HEK293, His-Avi) is the recombinant human-derived KIR3DL3/CD158z protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
KIR3DL3/CD158z, on natural killer cells, potentially inhibits NK cell activity, contributing to the prevention of cell lysis. This regulatory role underscores the significance of KIR3DL3 in modulating NK cell functions and maintaining immune homeostasis. KIR3DL3/CD158z Protein, Human (HEK293, His-Avi) is the recombinant human-derived KIR3DL3/CD158z protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
KIR3DL3, present on natural killer cells, acts as a receptor that potentially inhibits NK cell activity, thereby contributing to the prevention of cell lysis. This regulatory role underscores the significance of KIR3DL3 in modulating the functions of NK cells and maintaining immune homeostasis.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
Q8N743 (Q26-L322)
-
Molecular Construction
-
N-term
-
CD158z (Q26-L322)
Accession # Q8N743 -
8*His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
KIR3DL3; KIR2DS2*00101; Killer Cell Immunoglobulin Like Receptor, Three Ig Domains And Long Cytoplasmic Tail 3; KIR2DS2*00102; KIR3DL7; KIR2DS2*00105; CD158Z; KIR3DL3*00301; KIRC1; KIR3DL3*00402; Killer Cell Immunoglobulin-Like Receptor 3DL3; KIR3DL3*0070
-
AA Sequence
QDKPFLSAWPGTVVSEGQHVTLQCRSRLGFNEFSLSKEDGMPVPELYNRIFRNSFLMGPVTPAHAGTYRCCSSHPHSPTGWSAPSNPVVIMVTGVHRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGITEDPLRLVGQLHDAGSQVNYSMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVVGLYGKPSLSAQPGPTVQAGENVTLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQANFPLGPVTHGGNYRCFGSFRALPHAWSDPSDPLPVSVTGNSRHL
-
Predicted Molecular Mass
35.3 kDa
-
Molecular Weight
Approximately 48-52 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
