2. Recombinant Proteins
  3. CD Antigens Receptor Proteins
  4. NK Cell CD Proteins Killer-Cell Immunoglobulin-like Receptors
  5. CD158z/KIR3DL3 CD158z/KIR3DL3
  6. KIR3DL3/CD158z Protein, Human (HEK293, His)

KIR3DL3/CD158z Protein, Human (HEK293, His)

Cat. No.: HY-P77042
Handling Instructions

KIR3DL3/CD158z, on natural killer cells, potentially inhibits NK cell activity, contributing to the prevention of cell lysis. This regulatory role underscores the significance of KIR3DL3 in modulating NK cell functions and maintaining immune homeostasis. KIR3DL3/CD158z Protein, Human (HEK293, His) is the recombinant human-derived KIR3DL3/CD158z protein, expressed by HEK293 , with C-His labeled tag. The total length of KIR3DL3/CD158z Protein, Human (HEK293, His) is 297 a.a., with molecular weight of 40-50 KDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

KIR3DL3/CD158z, on natural killer cells, potentially inhibits NK cell activity, contributing to the prevention of cell lysis. This regulatory role underscores the significance of KIR3DL3 in modulating NK cell functions and maintaining immune homeostasis. KIR3DL3/CD158z Protein, Human (HEK293, His) is the recombinant human-derived KIR3DL3/CD158z protein, expressed by HEK293 , with C-His labeled tag. The total length of KIR3DL3/CD158z Protein, Human (HEK293, His) is 297 a.a., with molecular weight of 40-50 KDa.
Background

KIR3DL3, present on natural killer cells, acts as a receptor that potentially inhibits NK cell activity, thereby contributing to the prevention of cell lysis. This regulatory role underscores the significance of KIR3DL3 in modulating the functions of NK cells and maintaining immune homeostasis.
Species

Human
Source

HEK293
Tag

C-6*His
Accession

Q8N743/NP_703144.2 (Q26-L322)
Gene ID
Molecular Construction
N-term
CD158z (Q26-L322)
Accession # Q8N743/NP_703144.2
His
C-term
Synonyms
Killer cell immunoglobulin-like receptor 3DL3; CD158Z; KIR3DL7; KIRC1
AA Sequence

QDKPFLSAWPGTVVSEGQHVTLQCRSRLGFNEFSLSKEDGMPVPELYNRIFRNSFLMGPVTPAHAGTYRCCSSHPHSPTGWSAPSNPVVIMVTGVHRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGITEDPLRLVGQLHDAGSQVNYSMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVVGLYGKPSLSAQPGPTVQAGENVTLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQANFPLGPVTHGGNYRCFGSFRALPHAWSDPSDPLPVSVTGNSRHL

Molecular Weight

Approximately 40-50 kDa due to the glycosylation.
Purity

Greater than 95% as determined by reducing SDS-PAGE
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

KIR3DL3/CD158z Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KIR3DL3/CD158z Protein, Human (HEK293, His)
Cat. No.:
HY-P77042
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.