Copy Link Print Information

KIR3DL3/CD158z Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

KIR3DL3/CD158z, on natural killer cells, potentially inhibits NK cell activity, contributing to the prevention of cell lysis. This regulatory role underscores the significance of KIR3DL3 in modulating NK cell functions and maintaining immune homeostasis. KIR3DL3/CD158z Protein, Human (HEK293, His) is the recombinant human-derived KIR3DL3/CD158z protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for KIR3DL3/CD158z Protein, Human (HEK293, His)
  • Experimental Validation Results for KIR3DL3/CD158z Protein, Human (HEK293, His)
  • KIR3DL3/CD158z Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

KIR3DL3/CD158z, on natural killer cells, potentially inhibits NK cell activity, contributing to the prevention of cell lysis. This regulatory role underscores the significance of KIR3DL3 in modulating NK cell functions and maintaining immune homeostasis. KIR3DL3/CD158z Protein, Human (HEK293, His) is the recombinant human-derived KIR3DL3/CD158z protein, expressed by HEK293 , with C-His labeled tag.

Background

KIR3DL3, present on natural killer cells, acts as a receptor that potentially inhibits NK cell activity, thereby contributing to the prevention of cell lysis. This regulatory role underscores the significance of KIR3DL3 in modulating the functions of NK cells and maintaining immune homeostasis.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human HHLA2 at 0.5 μg/mL (100μL/well) can bind Biotinylated human KIR3DL3. The ED50 for this effect is 29.85-39.78ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Human HHLA2 at 0.5 μg/mL (100μL/well) can bind Biotinylated human KIR3DL3. The ED50 for this effect is 39.78 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q8N743/NP_703144.2 (Q26-L322)

  • Gene ID
    115653  [NCBI]
  • Molecular Construction
    • N-term
    • CD158z (Q26-L322)
      Accession # Q8N743/NP_703144.2
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    KIR3DL3; KIR2DS2*00101; Killer Cell Immunoglobulin Like Receptor, Three Ig Domains And Long Cytoplasmic Tail 3; KIR2DS2*00102; KIR3DL7; KIR2DS2*00105; CD158Z; KIR3DL3*00301; KIRC1; KIR3DL3*00402; Killer Cell Immunoglobulin-Like Receptor 3DL3; KIR3DL3*0070

  • AA Sequence

    QDKPFLSAWPGTVVSEGQHVTLQCRSRLGFNEFSLSKEDGMPVPELYNRIFRNSFLMGPVTPAHAGTYRCCSSHPHSPTGWSAPSNPVVIMVTGVHRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGITEDPLRLVGQLHDAGSQVNYSMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVVGLYGKPSLSAQPGPTVQAGENVTLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQANFPLGPVTHGGNYRCFGSFRALPHAWSDPSDPLPVSVTGNSRHL

  • Molecular Weight

    Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized Human HHLA2 at 0.5 μg/mL (100μL/well) can bind Biotinylated human KIR3DL3. The ED50 for this effect is 39.78 ng/mL.

  • KIR3DL3/CD158z Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for KIR3DL3/CD158z Protein, Human (HEK293, His)
  • Experimental Validation Results for KIR3DL3/CD158z Protein, Human (HEK293, His)
  • KIR3DL3/CD158z Protein, Human (HEK293, His) Product Image