KIR3DL3/CD158z Protein, Cynomolgus (HEK293, His)
KIR3DL3/CD158z Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived KIR3DL3/CD158z protein, expressed by HEK293, with C-His tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
KIR3DL3/CD158z Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived KIR3DL3/CD158z protein, expressed by HEK293, with C-His tag.
Background
KIR3DL3, present on natural killer cells, acts as a receptor that potentially inhibits NK cell activity, thereby contributing to the prevention of cell lysis. This regulatory role underscores the significance of KIR3DL3 in modulating the functions of NK cells and maintaining immune homeostasis.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-His
-
Accession
XP_005590394.1 (H22-L339)
-
Gene ID102144764
-
Protein Length
Partial
-
Synonyms
KIR3DL3; KIR2DS2*00101; Killer Cell Immunoglobulin Like Receptor, Three Ig Domains And Long Cytoplasmic Tail 3; KIR2DS2*00102; KIR3DL7; KIR2DS2*00105; CD158Z; KIR3DL3*00301; KIRC1; KIR3DL3*00402; Killer Cell Immunoglobulin-Like Receptor 3DL3; KIR3DL3*0070
-
AA Sequence
HVDGQDKPFLSAWPSAVVPQGEHVSLQCHSHLGFTIFSLYKEDGVPAPELYNRRFWKDILLGPVTPAHAGTYRCRGSHLHSPTEWSAPSNPLVITVTGVYRKPSLLAHPGPLVKSGEMVVLQCWSDMRFEHFLLHREGITEDPLHLTGQLHDGGSQANSSVGPMIPALAGTYRCFGSVAYSPYEWSAPSDPLDIVIIGLYEKPSLSAQPGPTVQAGENVTLSCSSQSSFDIYRLSRDGEAHGLRLPAVPRVSGTFKADFPLGPATHGGNYRCFGSFRALPYVWSHPSDPLPISVTGNSSSTWSSPTEPSSNTGIPRHL
-
Predicted Molecular Mass
36 kDa
-
Molecular Weight
Approximately 52 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
