Klrb1a Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
The Klrb1a protein is critical for stimulating NK cell cytotoxicity and contributes to immune defense mechanisms.Klrb1a exists as a homodimer with disulfide bonds and complexly regulates NK cell activity.Klrb1a Protein, Mouse (HEK293, His) is the recombinant mouse-derived Klrb1a protein, expressed by HEK293 , with N-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The Klrb1a protein is critical for stimulating NK cell cytotoxicity and contributes to immune defense mechanisms.Klrb1a exists as a homodimer with disulfide bonds and complexly regulates NK cell activity.Klrb1a Protein, Mouse (HEK293, His) is the recombinant mouse-derived Klrb1a protein, expressed by HEK293 , with N-His labeled tag.
The Klrb1a protein plays a pivotal role in stimulating natural killer (NK) cell cytotoxicity, contributing to the immune system's defense mechanisms. Existing as a homodimer with disulfide linkages, Klrb1a is intricately involved in modulating the activity of NK cells. Its interaction with the tyrosine kinase LCK suggests a potential mechanism for signal transduction or regulatory processes that enhance NK cell cytotoxicity. Through these molecular interactions, Klrb1a plays a key role in the orchestration of immune responses, particularly in the activation and regulation of NK cells, thereby contributing to the body's defense against various threats.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-His
-
Accession
P27811 (Q67-H227)
-
Gene ID17057 [NCBI]
-
Molecular Construction
-
N-term
-
His
-
Klrb1a (Q67-H227)
Accession # P27811 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
Killer cell lectin-like receptor subfamily B member 1A; NKR-P1A; CD161 antigen-like family member A; Lymphocyte antigen 55A; Ly-55A; NKR-P1.7; Natural killer cell surface protein P1-2; NKR-P1 2; CD161a; Klrb1a; Ly55; Ly55a; Nkrp1a
-
AA Sequence
QKPSIEKCYVLIQENLNKTTDCSAKLECPQDWLSHRDKCFHVSHVSNTWEEGLVDCDGKGATLMLIQDQEELRFLLDSIKEKYNSFWIGLRYTLPDMNWKWINGSTLNSDVLKITDDTENDSCAAISGDKVTFESCNSDNRWICQKELYHETLSNYVGYGH
-
Molecular Weight
Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
