KREMEN1 Protein, Human (HEK293, His)
Based on 1 Customer Validation
KREMEN1 Protein, Human (HEK293, His) is the recombinant human-derived KREMEN1 protein, expressed by HEK293, with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
KREMEN1 Protein, Human (HEK293, His) is the recombinant human-derived KREMEN1 protein, expressed by HEK293, with C-His labeled tag.
Background
KREMEN1 is a receptor for Dickkopf proteins that cooperates with DKK1/2 to inhibit Wnt/beta-catenin signaling by promoting the endocytosis of Wnt receptors LRP5 and LRP6. In the absence of DKK1, it potentiates Wnt-beta-catenin signaling by maintaining LRP5 or LRP6 at the cell membrane. KREMEN1 can also trigger apoptosis in a Wnt-independent manner, an activity inhibited upon DKK1 binding. It plays a role in limb development by attenuating Wnt signaling for proper limb patterning and negatively regulates bone formation. Additionally, KREMEN1 modulates cell fate decisions in the developing cochlea, inhibiting hair cell fate specification.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized human Dkk-1 at 2 μg/mL can bind Human KREMEN1. The ED50 for this effect is 0.315 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
Q96MU8-2/NP_114434.3 (A20-T394)
-
Molecular Construction
-
N-term
-
KREMEN1 (A20-T394)
Accession # Q96MU8-2/NP_114434.3 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
KREMEN1; Dickkopf Receptor; Prev. KREMEN; Kringle-Coding Gene Marking The Eye And The Nose; KRM1; Kringle Containing Transmembrane Protein; Kringle-Containing Protein Marking The Eye And The Nose; ECTD13; Kringle Domain-Containing Transmembrane Protein 1;
-
AA Sequence
ARPAPSPGLGPGPECFTANGADYRGTQNWTALQGGKPCLFWNETFQHPYNTLKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKYGEAASTECNSVCFGDHTQPCGGDGRIILFDTLVGACGGNYSAMSSVVYSPDFPDTYATGRVCYWTIRVPGASHIHFSFPLFDIRDSADMVELLDGYTHRVLARFHGRSRPPLSFNVSLDFVILYFFSDRINQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGSNSWAPPMGAGSHRVEGWT
-
Molecular Weight
Approximately 56 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
