Layilin/LAYN Protein, Human (HEK293, His)

Layilin/LAYN Protein serves as a receptor for hyaluronate and interacts with NF2, RDX, and TLN1. Layilin/LAYN Protein, Human (HEK293, His) is the recombinant human-derived Layilin/LAYN protein, expressed by HEK293 , with C-His labeled tag.

Layilin/LAYN serves as a receptor for hyaluronate, playing a crucial role in cellular interactions with this extracellular matrix component. Additionally, Layilin/LAYN interacts with NF2, RDX, and TLN1, suggesting its involvement in various cellular processes and signaling pathways mediated by these interacting proteins.

Measured by its binding ability in a functional ELISA. When LAYN is present at 5 μg/mL, the ED₅₀ for this effect is 22.38 μg/mL.

• 
  Measured by its binding ability in a functional ELISA.When LAYN is present at 5 μg/mL, the ED₅₀ for this effect is 22.38 μg/mL.

Human

HEK293

C-6*His

Q6UX15-2/NP_849156.1 (A22-E220)

143903  [NCBI]

Partial

ATGRLLSGQPVCRGGTQRPCYKVIYFHDTSRRLNFEEAKEACRRDGGQLVSIESEDEQKLIEKFIENLLPSDGDFWIGLRRREEKQSNSTACQDLYAWTDGSISQFRNWYVDEPSCGSEVCVVMYHQPSAPAGIGGPYMFQWNDDRCNMKNNFICKYSDEKPAVPSREAEGEETELTTPVLPEETQEEDAKKTFKESRE

Approximately 27-34 kDa due to the glycosylation

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.