LDHA Protein, Mouse (His)
LDHA protein catalyzes the simultaneous and stereospecific interconversion of pyruvate and lactate, accompanied by the reciprocal interconversion of NADH and NAD(+).LDHA Protein, Mouse (His) is the recombinant mouse-derived LDHA protein, expressed by E.coli , with N-His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
LDHA protein catalyzes the simultaneous and stereospecific interconversion of pyruvate and lactate, accompanied by the reciprocal interconversion of NADH and NAD(+).LDHA Protein, Mouse (His) is the recombinant mouse-derived LDHA protein, expressed by E.coli , with N-His labeled tag.
Background
LDHA Protein, an isoform of lactate dehydrogenase, plays a critical role in cellular metabolism. It catalyzes the conversion of pyruvate to lactate, generating energy under anaerobic conditions. Understanding the functions of LDHA Protein is essential for studying metabolic disorders and developing therapeutic strategies targeting altered metabolism in cancer and other diseases.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-His
-
Accession
P06151 (M1-F332)
-
Molecular Construction
-
N-term
-
His
-
LDHA (M1-F332)
Accession # P06151 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
LDHA; Epididymis Secretory Sperm Binding Protein Li 133P; Lactate Dehydrogenase A; Proliferation-Inducing Gene 19; L-Lactate Dehydrogenase A Chain; Lactate Dehydrogenase M; LDH Muscle Subunit; L-Lactate Dehydrogenase; Cell Proliferation-Inducing Gene 19 P
-
AA Sequence
MATLKDQLIVNLLKEEQAPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLKTPKIVSSKDYCVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKYSPHCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPELGTDADKEQWKEVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGINEDVFLSVPCILGQNGISDVVKVTLTPEEEARLKKSADTLWGIQKELQF
-
Predicted Molecular Mass
36.5 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)