LECT1 Protein, Human (HEK293, Fc)
The LECT1 protein is a bifunctional growth regulator that stimulates the growth of cultured chondrocytes via FGF, thereby promoting cartilage expansion. Instead, it inhibits vascular endothelial cell growth, in contrast to its effect on endothelial proliferation. LECT1 Protein, Human (HEK293, Fc) is the recombinant human-derived LECT1 protein, expressed by HEK293 , with N-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The LECT1 protein is a bifunctional growth regulator that stimulates the growth of cultured chondrocytes via FGF, thereby promoting cartilage expansion. Instead, it inhibits vascular endothelial cell growth, in contrast to its effect on endothelial proliferation. LECT1 Protein, Human (HEK293, Fc) is the recombinant human-derived LECT1 protein, expressed by HEK293 , with N-hFc labeled tag.
Background
The LECT1 protein functions as a bifunctional growth regulator, exhibiting a dual role in cellular growth regulation. It stimulates the growth of cultured chondrocytes in the presence of basic fibroblast growth factor (FGF), suggesting a role in promoting the expansion of cartilage. Conversely, LECT1 inhibits the growth of cultured vascular endothelial cells, highlighting its contrasting effect on endothelial cell proliferation. This bifunctional nature may contribute to the coordinated regulation of cartilage growth and vascular invasion during endochondral bone development, where LECT1 is implicated in the rapid growth of cartilage preceding its replacement by bone. Moreover, LECT1 serves as an antiangiogenic factor in cardiac valves, suppressing neovascularization by inhibiting in vitro tube formation and the mobilization of endothelial cells. These multifaceted activities underscore LECT1's intricate involvement in the regulation of both chondrogenesis and angiogenesis processes.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-hFc
-
Accession
NP_001011705.1 (E215-V333)
-
Molecular Construction
-
N-term
-
hFc
-
LECT1 (E215-V333)
Accession # NP_001011705.1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
CNMD; CHM1; Prev. MYETS1; Leukocyte Cell Derived Chemotaxin 1; Prev. LECT1; BRICHOS Domain Containing 3; Leukocyte Cell-Derived Chemotaxin 1; Chondromodulin-1; BRICD3; Chondromodulin-I; CHM-I; CHMI; Chondromodulin; Multiple Myeloma Tumor Suppressor 1
-
AA Sequence
EVVRKIVPTTTKRPHSGPRSNPGAGRLNNETRPSVQEDSQAFNPDNPYHQQEGESMTFDPRLDHEGICCIECRRSYTHCQKICEPLGGYYPWPYNYQGCRSACRVIMPCSWWVARILGMV
-
Predicted Molecular Mass
42.1 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
