LIF Protein, Human

5 Cited Publications
Customer Review

Based on 5 publication(s) in Google Scholar

LIF Protein, Human is a lymphoid factor involved in various neural and inflammatory processes such as the acute-phase reaction, tissue damage, and infection.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

LIF Protein, Human is a lymphoid factor involved in various neural and inflammatory processes such as the acute-phase reaction, tissue damage, and infection.

Background

Leukemia Inhibitory Factor has been shown to possess a remarkable variety of actions. It releases calcium from bone tissue, and is the differentiation inhibitory factor preventing spontaneous differentiation in normal embryonic stem cells[1]. Leukemia inhibitory factor (LIF) is a neuropoietic cytokine involved in both the neural and immune responses to injury. Its levels are increased in a variety of animal and human inflammatory conditions. Administration of Leukemia Inhibitory Factor can suppress inflammatory signs in some cases, for instance after intratracheal lipopolysaccharide-induced inflammation. Leukemia Inhibitory Factor also increases corticosterone levels via the hypothalamo-pituitary-adrenal axis. Other evidence suggests, that it can also act as a proinflammatory cytokine. Exogenously added Leukemia Inhibitory Factor induces acute phase protein expression and stimulates the production of proinflammatory cytokines and monocyte chemoattractants[2].

Verified Bioactivity

1.The ED50 is <0.2 ng/mL as measured by TF-1 cells, corresponding to a specific activity of >4.9 × 106 units/mg.
2.Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 25-204.1 pg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED ED50 for this effect is 0.1155 ng/mL, corresponding to a specific activity is 8.658×106units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • LIF (S23-F202)
      Accession # P15018-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    LIF; Hepatocyte-Stimulating Factor III; LIF Interleukin 6 Family Cytokine; Differentiation-Inducing Factor; HILDA; Melanoma-Derived LPL Inhibitor; Leukemia Inhibitory Factor; Human Interleukin In DA Cells; CDF; D Factor; DIA; MLPLI; Differentiation Inhibi

  • AA Sequence

    SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

  • Predicted Molecular Mass

    19.7 kDa

  • Molecular Weight

    Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00