LIF Protein, Human
Based on 5 publication(s) in Google Scholar
LIF Protein, Human is a lymphoid factor involved in various neural and inflammatory processes such as the acute-phase reaction, tissue damage, and infection.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
LIF Protein, Human is a lymphoid factor involved in various neural and inflammatory processes such as the acute-phase reaction, tissue damage, and infection.
Leukemia Inhibitory Factor has been shown to possess a remarkable variety of actions. It releases calcium from bone tissue, and is the differentiation inhibitory factor preventing spontaneous differentiation in normal embryonic stem cells[1]. Leukemia inhibitory factor (LIF) is a neuropoietic cytokine involved in both the neural and immune responses to injury. Its levels are increased in a variety of animal and human inflammatory conditions. Administration of Leukemia Inhibitory Factor can suppress inflammatory signs in some cases, for instance after intratracheal lipopolysaccharide-induced inflammation. Leukemia Inhibitory Factor also increases corticosterone levels via the hypothalamo-pituitary-adrenal axis. Other evidence suggests, that it can also act as a proinflammatory cytokine. Exogenously added Leukemia Inhibitory Factor induces acute phase protein expression and stimulates the production of proinflammatory cytokines and monocyte chemoattractants[2].
1.The ED50 is <0.2 ng/mL as measured by TF-1 cells, corresponding to a specific activity of >4.9 × 106 units/mg.
2.Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 25-204.1 pg/mL.
-
Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED ED50 for this effect is 0.1155 ng/mL, corresponding to a specific activity is 8.658×106units/mg.
Publications (5)
-
Journal Impact Factor
-
Most Recent
-
Adv Sci (Weinh)
DTX3L Inhibits the EMT, Metastasis, and Stem-Like Features of Gastric Cancer Through Promoting GSK-3β Dependent SNAI1 Decay. [Abstract]2026 Jul;13(37):e24036. PMID: 41972409 -
Sci Adv
DLX2 acts as a pioneer factor and drives Msx1+ ectomesenchyme formation from embryonic stem cells. [Abstract]2026 Jan 16;12(3):eaea0685. PMID: 41533791 -
Int J Mol Sci
Establishment and Characterization of a Long-Term Ovarian Cell Line (SBO) from Asian Seabass (Lates calcarifer) Expressing Germline Stem Cell Markers. [Abstract]2026 May 21;27(10):4608. PMID: 42196585 -
Animals (Basel)
Derivation of Equine Mesenchymal Stem/Stromal Cells from Induced Pluripotent Stem Cells via the Neural Crest Pathway and Characterisation by Immunophenotype and Tri-Lineage Differentiation. [Abstract]2026 May 26;16(11):1618. PMID: 42278052 -
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P15018-1 (S23-F202)
-
Molecular Construction
-
N-term
-
LIF (S23-F202)
Accession # P15018-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Synonyms
rHuLIF; Differentiation-stimulating Factor; D factor; MLPLI; Emfilermin; 159075-60-2
-
AA Sequence
SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
-
Predicted Molecular Mass
19.7 kDa
-
Molecular Weight
Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
-
≥ 95%, as determined by reducing SDS-PAGE.
-
Product Properties
Lyophilized powder.
Lyophilized after extensive dialysis against PBS.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Metcalf D, et al. Effects of injected leukemia inhibitory factor on hematopoietic and other tissues in mice. Blood. 1990 Jul 1;76(1):50-6. [Content Brief]
[2]. Banner LR, et al. Leukemia inhibitory factor is an anti-inflammatory and analgesic cytokine. J Neurosci. 1998 Jul 15;18(14):5456-62. [Content Brief]
[3]. Gearing DP, et al. Leukemia inhibitory factor receptor is structurally related to the IL-6 signal transducer, gp130. EMBO J. 1991 Oct;10(10):2839-48. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
