LIGHT/TNFSF14 Protein, Mouse (HEK293, His)
LIGHT/TNFSF14 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LIGHT/TNFSF14 protein, expressed by HEK293, with N-His tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
LIGHT/TNFSF14 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LIGHT/TNFSF14 protein, expressed by HEK293, with N-His tag.
Background
LIGHT/TNFSF14 is a cytokine that binds to TNFRSF3/LTBR. Its effects are modulated by binding to the decoy receptor TNFRSF6B. It activates NFKB and stimulates the proliferation of T-cells. Additionally, LIGHT/TNFSF14 acts as a ligand for TNFRSF14/HVEM. Upon binding to TNFRSF14/HVEM, it delivers costimulatory signals to T cells, resulting in T cell proliferation and IFNG production (By similarity).
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-His
-
Accession
Q9QYH9-1 (D72-V239)
-
Gene ID50930
-
Molecular Construction
-
N-term
-
His
-
LIGHT (D72-V239)
Accession # Q9QYH9-1 -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
TNFSF14; Tumor Necrosis Factor Ligand Superfamily Member 14; TNF Superfamily Member 14; Herpesvirus Entry Mediator Ligand; LIGHT; HVEML; HVEM-L; Tumor Necrosis Factor Superfamily Member 14; CD258; Herpes Virus Entry Mediator Ligand; LTg; Tumor Necrosis Fa
-
AA Sequence
DGGKGSWEKLIQDQRSHQANPAAHLTGANASLIGIGGPLLWETRLGLAFLRGLTYHDGALVTMEPGYYYVYSKVQLSGVGCPQGLANGLPITHGLYKRTSRYPKELELLVSRRSPCGRANSSRVWWDSSFLGGVVHLEAGEEVVVRVPGNRLVRPRDGTRSYFGAFMV
-
Predicted Molecular Mass
58.9 kDa
-
Molecular Weight
Approximately 55-60 kDa & 65-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
