LILRA5/CD85f Protein, Human (Biotinylated, HEK293, His-Avi)
The LILRA5/CD85f protein may trigger innate immune responses independently of recognition of MHC class I antigens. This unique feature suggests a unique role in early defense against pathogens, acting through a pathway that is independent of MHC class I antigen recognition. LILRA5/CD85f Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived LILRA5/CD85f protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The LILRA5/CD85f protein may trigger innate immune responses independently of recognition of MHC class I antigens. This unique feature suggests a unique role in early defense against pathogens, acting through a pathway that is independent of MHC class I antigen recognition. LILRA5/CD85f Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived LILRA5/CD85f protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.
Background
LILRA5/CD85f Protein is suggested to potentially play a role in triggering innate immune responses, indicating its involvement in the early defense mechanisms against pathogens. However, it does not appear to have a role in recognizing any class I major histocompatibility complex (MHC) antigens. This distinctive feature suggests that LILRA5/CD85f may exert its immune-modulating effects through pathways independent of class I MHC antigen recognition, highlighting its unique role in the intricate landscape of innate immune responses. The specific molecular mechanisms underlying its participation in triggering innate immunity remain to be fully elucidated, warranting further exploration into its functional significance in the context of the immune system.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-6*His
-
Accession
A6NI73-1 (G42-R268)
-
Molecular Construction
-
N-term
-
LILRA5 (G42-R268)
Accession # A6NI73-1 -
6*His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
LILRA5; Leucocyte Ig-Like Receptor A5; Prev. LILRB7; LIR-9; ILT11; Leukocyte Immunoglobulin-Like Receptor, Subfamily B (With TM And ITIM Domains), Member 7; LIR9; Leukocyte Immunoglobulin-Like Receptor Subfamily A Member 5 Soluble; CD85f; Immunoglobulin-L
-
AA Sequence
GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR
-
Predicted Molecular Mass
27.9 kDa
-
Molecular Weight
Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
