LRG1 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
LRG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LRG1 protein, expressed by HEK293, with C-8*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
LRG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LRG1 protein, expressed by HEK293, with C-8*His labeled tag.
Background
LRG1 is a member of the leucine-rich repeat sequence (LRR) family of proteins involved in protein-protein interactions, signal transduction, and cell adhesion and development. LRG1 is involved in promoting neovascularization (new blood vessel growth) by causing the switching of transforming growth factor β (TGF-β) signaling in endothelial cells. LRG1 binds to the co-receptor endorphins and promotes signaling through the ALK1-Smad1/5/8 pathway. LRG1 is involved in ovarian cancer progression by activating the FAK/AKT signaling pathway[1][2][3].
Verified Bioactivity
Immobilized Mouse LRG1 Protein at 2 μg/mL (100 μL/well) can bind LRG1 antibody .The ED50 for this effect is 77.86-89.21 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-8*His
-
Accession
Q91XL1 (L33-L342)
-
Molecular Construction
-
N-term
-
LRG1 (L33-L342)
Accession # Q91XL1 -
8*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
LRG1; Leucine-Rich Alpha-2-Glycoprotein; Leucine Rich Alpha-2-Glycoprotein 1; 1300008B03Rik; LRG; 2310031E04Rik; Leucine Rich Alpha 2 Glycoprotein; HMFT1766
-
AA Sequence
LKECLILQSAEGSTVSCHGPTEFPSSLPADTVHLSVEFSNLTQLPAAALQGCPGLRELHLSSNRLQALSPELLAPVPRLRALDLTRNALRSLPPGLFSTSANLSTLVLRENQLREVSAQWLQGLDALGHLDLAENQLSSLPSGLLASLGALHTLDLGYNLLESLPEGLLRGPRRLQRLHLEGNRLQRLEDSLLAPQPFLRVLFLNDNQLVGVATGSFQGLQHLDMLDLSNNSLSSTPPGLWAFLGRPTRDMQDGFDISHNPWICDKNLADLCRWLVANRNKMFSQNDTRCAGPEAMKGQRLLDVAELGSL
-
Predicted Molecular Mass
35 kDa
-
Molecular Weight
Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE or Bis-Tris PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
