M-CSF Protein, Human (Biotinylated, HEK293, His-Avi)
The M-CSF protein is an important cytokine that modulates hematopoietic precursor cells, especially mononuclear phagocytes, affecting innate immunity and inflammation through the release of proinflammatory chemokines. It is essential for osteoclast proliferation and regulates bone resorption, bone development and fertility. M-CSF Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived M-CSF protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The M-CSF protein is an important cytokine that modulates hematopoietic precursor cells, especially mononuclear phagocytes, affecting innate immunity and inflammation through the release of proinflammatory chemokines. It is essential for osteoclast proliferation and regulates bone resorption, bone development and fertility. M-CSF Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived M-CSF protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
M-CSF Protein is a vital cytokine involved in regulating the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes like macrophages and monocytes. It plays a crucial role in innate immunity and inflammatory processes by promoting the release of pro-inflammatory chemokines. Additionally, M-CSF Protein is essential for osteoclast proliferation and differentiation, regulating bone resorption, and normal bone development. It is also necessary for normal male and female fertility. Moreover, M-CSF Protein contributes to the reorganization of the actin cytoskeleton, facilitating membrane ruffle formation, cell adhesion, and cell migration. Furthermore, it plays a role in lipoprotein clearance. M-CSF Protein can exist in different forms, such as homodimer or heterodimer configurations, and it interacts with CSF1R.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
P09603-1 (E33-R255)
-
Protein Length
Full Length of M-CSF 43 kDa subunit Chain
-
Conjugation
Biotin
-
Synonyms
CSF1; Macrophage Colony Stimulating Factor 1; Colony Stimulating Factor 1; Lanimostim; MCSF; MGC31930; Proteoglycan Macrophage Colony-Stimulating Factor; PG-M-CSF; Macrophage Colony-Stimulating Factor 1; CSF-1; M-CSF; CSF1-HERV-LTR71B Fusion Protein; Colo
-
AA Sequence
EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPR
-
Predicted Molecular Mass
28.8 kDa
-
Molecular Weight
Approximately 35-48 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)