Copy Link Print Information

Marapsin/Pancreasin Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

Marapsin/pancreatin protein shows predominant expression in the pancreas, emphasizing its central role in pancreatic tissue. As a key member within this organ, marapsin/pancreatin may play a crucial role in pancreatic function and processes. Marapsin/Pancreasin Protein, Human (HEK293, His) is the recombinant human-derived Marapsin/Pancreasin protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Marapsin/Pancreasin Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Marapsin/pancreatin protein shows predominant expression in the pancreas, emphasizing its central role in pancreatic tissue. As a key member within this organ, marapsin/pancreatin may play a crucial role in pancreatic function and processes. Marapsin/Pancreasin Protein, Human (HEK293, His) is the recombinant human-derived Marapsin/Pancreasin protein, expressed by HEK293 , with C-His labeled tag.

Background

The Marapsin/Pancreasin protein, is predominantly expressed in the pancreas. This specific tissue distribution suggests a specialized role for Marapsin/Pancreasin within pancreatic function. Given its association with the pancreas, this protein likely plays a role in processes related to pancreatic physiology, such as enzyme secretion, digestion, or maintenance of tissue homeostasis. Further exploration of Marapsin/Pancreasin's molecular functions and interactions within the pancreas could provide valuable insights into its contributions to pancreatic health and function, potentially uncovering its involvement in key aspects of digestive processes or regulatory mechanisms specific to this vital organ.

Verified Bioactivity

Measured by its ability to cleave a colorimetric peptide substrate, Z-GR-SBzl, in the presence of DTNB that incubate at room temperature in kinetic mode for 5 minutes. The specific activity is 12844.08 pmol/min/μg,

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q9BQR3 (A23-K290)

  • Gene ID
    83886  [NCBI]
  • Molecular Construction
    • N-term
    • Marapsin (A23-K290)
      Accession # Q9BQR3
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    PRSS27; Marapsin; Serine Protease 27; CAPH2; MPN; Protease, Serine 27; Pancreasin; Channel-Activating Protease 2

  • AA Sequence

    ATACGRPRMLNRMVGGQDTQEGEWPWQVSIQRNGSHFCGGSLIAEQWVLTAAHCFRNTSETSLYQVLLGARQLVQPGPHAMYARVRQVESNPLYQGTASSADVALVELEAPVPFTNYILPVCLPDPSVIFETGMNCWVTGWGSPSEEDLLPEPRILQKLAVPIIDTPKCNLLYSKDTEFGYQPKTIKNDMLCAGFEEGKKDACKGDSGGPLVCLVGQSWLQAGVISWGEGCARQNRPGVYIRVTAHHNWIHRIIPKLQFQPARLGGQK

  • Molecular Weight

    Approximately 42 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Marapsin/Pancreasin Protein, Human (HEK293, His) Product Image
    1/16
  • Marapsin/Pancreasin Protein, Human (HEK293, His) Product Image