Copy Link Print Information

Matriptase/ST14 Catalytic Domain Protein, Human

Customer Review

Based on 1 Customer Validation

The Matriptase/ST14 catalytic domain protein originates from epithelial cells, forms a complex with HAI-1, and is activated by sphingosine-1-phosphate. It cleaves and activates hepatocyte growth factor/scatter factor and urokinase plasminogen activator, suggesting its role as an activator of other proteases and potential growth factors. Matriptase/ST14 Catalytic Domain Protein, Human is the recombinant human-derived Matriptase/ST14 Catalytic Domain protein, expressed by E. coli, with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Matriptase/ST14 Catalytic Domain Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The Matriptase/ST14 catalytic domain protein originates from epithelial cells, forms a complex with HAI-1, and is activated by sphingosine-1-phosphate. It cleaves and activates hepatocyte growth factor/scatter factor and urokinase plasminogen activator, suggesting its role as an activator of other proteases and potential growth factors. Matriptase/ST14 Catalytic Domain Protein, Human is the recombinant human-derived Matriptase/ST14 Catalytic Domain protein, expressed by E. coli, with tag free.

Background

The Matriptase/ST14 Catalytic Domain Protein is an integral membrane serine protease derived from epithelial cells. It forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is activated by sphingosine 1-phosphate. This protease has been demonstrated to cleave and activate hepatocyte growth factor/scattering factor, as well as urokinase plasminogen activator, suggesting its role as an activator for other proteases and latent growth factors on the epithelial membrane. The expression of this protease has been linked to breast, colon, prostate, and ovarian tumors, indicating its involvement in cancer invasion and metastasis. It exhibits broad expression in colon (RPKM 103.0), small intestine (RPKM 72.7), and 15 other tissues.

Verified Bioactivity

Measured by its ability to cleave the fluorogenic peptide substrate Boc-QAR-AMC. The specific activity is >15,000 pmol/min/μg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    NP_068813 (G596-V855)

  • Gene ID
    6768
  • Molecular Construction
    • N-term
    • Matriptase (G596-V855)
      Accession # NP_068813
    • C-term
  • Protein Length

    Partial

  • Synonyms

    ST14; Matriptase; Prev. PRSS14; TADG15; MT-SP1; Suppression Of Tumorigenicity 14 (Colon Carcinoma, Matriptase, Epithin); SNC19; Tumor Associated Differentially Expressed Gene 15 Protein; TMPRSS14; Tumor-Associated Differentially-Expressed Gene 15 Protein; CAP3; Suppression Of Tumorigenicity 14; HAI; Channel–Activating Protein 3; Suppression Of Tumorigenicity 14 (Colon Carcinoma); Channel-Activating Protein 3; Suppressor Of Tumorigenicity 14 Protein; ST14 Protein; Membrane-Type Serine Protease 1; Epithin; Serine Protease TADG-15; ARCI11; Serine Protease 14; MTSP1; ST14 Transmembrane Serine Protease Matriptase; Prostamin

  • AA Sequence

    GSDEKDCDCGLRSFTRQARVVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV

  • Predicted Molecular Mass

    30.6 kDa

  • Molecular Weight

    Approximately 27-28 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as 0.22 μm filtered solution of 50 mM Tris, 150 mM NaCl, 10% trehalose, pH 7.5 with 50% glycerol as protectant.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

/

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Matriptase/ST14 Catalytic Domain Protein, Human Product Image
    1/16
  • Matriptase/ST14 Catalytic Domain Protein, Human Product Image