Copy Link Print Information

MBL1 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

MBL1, a calcium-dependent lectin, recognizes microbial moieties, activating the lectin complement pathway.It also binds apoptotic and necrotic cells, aiding uptake by macrophages.As a homotrimer, MBL1 forms higher oligomeric complexes in the endoplasmic reticulum.MBL1's interaction with MASP1 and MASP2 enhances its role in immune response modulation and cellular recognition.MBL1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MBL1 protein, expressed by HEK293 , with N-His, N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for MBL1 Protein, Mouse (HEK293, His)
  • MBL1 Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

MBL1, a calcium-dependent lectin, recognizes microbial moieties, activating the lectin complement pathway.It also binds apoptotic and necrotic cells, aiding uptake by macrophages.As a homotrimer, MBL1 forms higher oligomeric complexes in the endoplasmic reticulum.MBL1's interaction with MASP1 and MASP2 enhances its role in immune response modulation and cellular recognition.MBL1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MBL1 protein, expressed by HEK293 , with N-His, N-6*His labeled tag.

Background

MBL1, a calcium-dependent lectin, plays a crucial role in the innate immune response by recognizing mannose, fucose, and N-acetylglucosamine moieties on various microorganisms, thereby activating the lectin complement pathway. Beyond its microbial interactions, MBL1 also binds to late apoptotic cells, apoptotic blebs, and necrotic cells, facilitating their uptake by macrophages. Existing as a homotrimer, MBL1 further assembles into higher oligomeric complexes through the association of two, three, or more homotrimers, a process occurring in the endoplasmic reticulum. Additionally, MBL1 interacts with MASP1 and MASP2, further contributing to its involvement in immune response modulation and cellular recognition processes.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Mannan (HY-W145667) at 50 μg/mL (100 μL/well) can bind Biotinylated MBL1. The ED50 for this effect is 0.653 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag N-6*His
  • Accession

    P39039-1/NP_034905.1 (S21-A239)

  • Gene ID
    17194  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • MBL1 (S21-A239)
      Accession # P39039-1/NP_034905.1
    • C-term
  • Protein Length

    Full Length of Mannose-binding protein A Chain

  • Synonyms

    Mannose-binding protein A; Mannan-binding protein; MBP-A; Ra-reactive factor polysaccharide-binding component p28B; RaRF p28B; Mbl1

  • AA Sequence

    SQTCEDTLKTCSVIACGRDGRDGPKGEKGEPGQGLRGLQGPPGKLGPPGSVGSPGSPGPKGQKGDHGDNRAIEEKLANMEAEIRILKSKLQLTNKLHAFSMGKKSGKKLFVTNHEKMPFSKVKSLCTELQGTVAIPRNAEENKAIQEVATGIAFLGITDEATEGQFMYVTGGRLTYSNWKKDEPNNHGSGEDCVIILDNGLWNDISCQASFKAVCEFPA

  • Predicted Molecular Mass

    24.2 kDa

  • Molecular Weight

    Approximately 30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • MBL1 Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for MBL1 Protein, Mouse (HEK293, His)
  • MBL1 Protein, Mouse (HEK293, His) Product Image