MCP-3/CCL7 Protein, Rat

MCP-3/CCL7 Protein, Rat  is a CC chemokine and elicitor that binds to CCR1, CCR2 and CCR3 to mediate antiviral, antibacterial, antitumor and other immune responses. MCP-3/CCL7 Protein, Rat is a recombinant rat MCP-3/CCL7 protein expressed by E.coilMCP-3/CCL7 (Q24-P97)^[1].

CCL7, also known as monocyte chemotactic protein 3 (MCP3), is a small cell factor. In the human genome, CCL7 is encoded by the CCL7 gene located on chromosome 17q11.2-q12. It consists of 99 amino acids, including a signal peptide of 23 amino acids, while a mature protein of approximately 76 amino acids is secreted upon signal peptide cleavage. CCL7 is expressed in a variety of cell types, such as stromal cells, keratin-forming cells, airway smooth muscle cells, parenchymal cells, fibroblasts and leukocytes, and tumor cells^[1]. CCL7 is generally present as a monomer and can bind to a variety of receptors, including CCR1, CCR2, CCR3, CCR5 and CCR10 to mediate effects on immune cell types.CCL7 can act as a chemoattractant, attracting a variety of leukocytes, including monocytes and neutrophils. It mediates the immune response by recruiting leukocytes to infected tissues and is also involved in monocyte mobilization and recruitment of monocytes to sites of inflammation, as well as inducing neutrophil migration to sites of inflammation by increasing intracellular Ca²⁺ flux. CCL7 is involved in antibacterial, antiviral and antifungal immune responses, as well as being associated with various immune diseases such as ulcerative colitis, multiple sclerosis or non-atopic and atopic asthma. At the same time, CCL7 expression activates antitumor immune responses^[2].

Full biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 10-100 ng/ml.

Rat

E. coli

Tag Free

Q9QXY8 (Q24-P97)

287561  [NCBI]

Full Length of Mature Protein

QPDGTNSSTCCYVKKQKIPKRNLKSYRKITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTSTPKP

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. G Opdenakker, et al. The human MCP-3 gene (SCYA7): cloning, sequence analysis, and assignment to the C-C chemokine gene cluster on chromosome 17q11.2-q12. Genomics. 1994 May 15;21(2):403-8.  [Content Brief]

  [2]. F Fioretti, et al. Reduced tumorigenicity and augmented leukocyte infiltration after monocyte chemotactic protein-3 (MCP-3) gene transfer: perivascular accumulation of dendritic cells in peritumoral tissue and neutrophil recruitment within the tumor. J Immunol. 1998 Jul 1;161(1):342-6.  [Content Brief]