MCP-3/CCL7 Protein, Rat

Customer Review

Based on 1 Customer Validation

MCP-3/CCL7 Protein, Rat  is a CC chemokine and elicitor that binds to CCR1, CCR2 and CCR3 to mediate antiviral, antibacterial, antitumor and other immune responses. MCP-3/CCL7 Protein, Rat is a recombinant rat MCP-3/CCL7 protein expressed by E.coilMCP-3/CCL7 (Q24-P97).

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

MCP-3/CCL7 Protein, Rat  is a CC chemokine and elicitor that binds to CCR1, CCR2 and CCR3 to mediate antiviral, antibacterial, antitumor and other immune responses. MCP-3/CCL7 Protein, Rat is a recombinant rat MCP-3/CCL7 protein expressed by E.coilMCP-3/CCL7 (Q24-P97)[1].

Background

CCL7, also known as monocyte chemotactic protein 3 (MCP3), is a small cell factor. In the human genome, CCL7 is encoded by the CCL7 gene located on chromosome 17q11.2-q12. It consists of 99 amino acids, including a signal peptide of 23 amino acids, while a mature protein of approximately 76 amino acids is secreted upon signal peptide cleavage. CCL7 is expressed in a variety of cell types, such as stromal cells, keratin-forming cells, airway smooth muscle cells, parenchymal cells, fibroblasts and leukocytes, and tumor cells[1]. CCL7 is generally present as a monomer and can bind to a variety of receptors, including CCR1, CCR2, CCR3, CCR5 and CCR10 to mediate effects on immune cell types.CCL7 can act as a chemoattractant, attracting a variety of leukocytes, including monocytes and neutrophils. It mediates the immune response by recruiting leukocytes to infected tissues and is also involved in monocyte mobilization and recruitment of monocytes to sites of inflammation, as well as inducing neutrophil migration to sites of inflammation by increasing intracellular Ca2+ flux. CCL7 is involved in antibacterial, antiviral and antifungal immune responses, as well as being associated with various immune diseases such as ulcerative colitis, multiple sclerosis or non-atopic and atopic asthma. At the same time, CCL7 expression activates antitumor immune responses[2].

Verified Bioactivity

Full biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 10-100 ng/ml.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Rat
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CCL7 (Q24-P97)
      Accession # Q9QXY8
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CCL7; Monocyte Chemotactic Protein 3; Prev. SCYA6; FIC; Prev. SCYA7; Small Inducible Cytokine A7 (Monocyte Chemotactic Protein 3); MCP-3; Chemokine (C-C Motif) Ligand 7; NC28; Small-Inducible Cytokine A7; MCP3; C-C Motif Chemokine 7; Monocyte Chemoattract

  • AA Sequence

    QPDGTNSSTCCYVKKQKIPKRNLKSYRKITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTSTPKP

  • Predicted Molecular Mass

    8.5 kDa

  • Molecular Weight

    Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00