Melanotransferrin/CD228 Protein, Human (352a.a, HEK293, His)
Melanotransferrin, or CD228, is vital for cellular iron uptake, binding a single iron atom per subunit. The protein is involved in internalization and recycling to the cell membrane, with additional potential versatility in zinc binding. Melanotransferrin/CD228 Protein, Human (349a.a, HEK293, His) is the recombinant human-derived Melanotransferrin/CD228 protein, expressed by HEK293, with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Melanotransferrin, or CD228, is vital for cellular iron uptake, binding a single iron atom per subunit. The protein is involved in internalization and recycling to the cell membrane, with additional potential versatility in zinc binding. Melanotransferrin/CD228 Protein, Human (349a.a, HEK293, His) is the recombinant human-derived Melanotransferrin/CD228 protein, expressed by HEK293, with C-His labeled tag.
Background
Melanotransferrin, also known as CD228, plays a crucial role in cellular iron uptake by binding a single atom of iron per subunit. The protein is implicated in the internalization and subsequent recycling back to the cell membrane. Notably, melanotransferrin exhibits the capacity to bind zinc, suggesting potential versatility in metal ion interactions.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P08582-1 (D358-C709)
-
Gene ID4241
-
Molecular Construction
-
N-term
-
Melanotransferrin (D358-C709)
Accession # P08582-1 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
MELTF; Antigen P97 (Melanoma Associated) Identified By Monoclonal Antibodies 133.2 And 96.5; Prev. MFI2; FLJ38863; MAP97; MGC4856; CD228; Melanoma-Associated Antigen P97; MTF1; CD228 Antigen; MTf; Melanotransferrin; Membrane-Bound Transferrin-Like Protein
-
AA Sequence
DPNRLPPYLRWCVLSTPEIQKCGDMAVAFRRQRLKPEIQCVSAKSPQHCMERIQAEQVDAVTLSGEDIYTAGKTYGLVPAAGEHYAPEDSSNSYYVVAVVRRDSSHAFTLDELRGKRSCHAGFGSPAGWDVPVGALIQRGFIRPKDCDVLTAVSEFFNASCVPVNNPKNYPSSLCALCVGDEQGRNKCVGNSQERYYGYRGAFRCLVENAGDVAFVRHTTVFDNTNGHNSEPWAAELRSEDYELLCPNGARAEVSQFAACNLAQIPPHAVMVRPDTNIFTVYGLLDKAQDLFGDDHNKNGFKMFDSSNYHGQDLLFKDATVRAVPVGEKTTYRGWLGLDYVAALEGMSSQQC
-
Predicted Molecular Mass
40.5 kDa.
-
Molecular Weight
Approximately 45-50 kDa, based on Bis-Tris PAGE, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
