Melanotransferrin/CD228 Protein, Human (349a.a, HEK293, His)

Melanotransferrin, or CD228, is vital for cellular iron uptake, binding a single iron atom per subunit. The protein is involved in internalization and recycling to the cell membrane, with additional potential versatility in zinc binding. Melanotransferrin/CD228 Protein, Human (349a.a, HEK293, His) is the recombinant human-derived Melanotransferrin/CD228 protein, expressed by HEK293, with C-His labeled tag.

Melanotransferrin, also known as CD228, plays a crucial role in cellular iron uptake by binding a single atom of iron per subunit. The protein is implicated in the internalization and subsequent recycling back to the cell membrane. Notably, melanotransferrin exhibits the capacity to bind zinc, suggesting potential versatility in metal ion interactions.

Human

HEK293

C-His

P08582-1 (D358-S706)

4241

Partial

DPNRLPPYLRWCVLSTPEIQKCGDMAVAFRRQRLKPEIQCVSAKSPQHCMERIQAEQVDAVTLSGEDIYTAGKTYGLVPAAGEHYAPEDSSNSYYVVAVVRRDSSHAFTLDELRGKRSCHAGFGSPAGWDVPVGALIQRGFIRPKDCDVLTAVSEFFNASCVPVNNPKNYPSSLCALCVGDEQGRNKCVGNSQERYYGYRGAFRCLVENAGDVAFVRHTTVFDNTNGHNSEPWAAELRSEDYELLCPNGARAEVSQFAACNLAQIPPHAVMVRPDTNIFTVYGLLDKAQDLFGDDHNKNGFKMFDSSNYHGQDLLFKDATVRAVPVGEKTTYRGWLGLDYVAALEGMSS

Approximately 45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

<1 EU/μg, determined by LAL method.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.