METTL1 Protein, Human (His)
Based on 1 Customer Validation
The METTL1 protein is a catalytic component of the METTL1-WDR4 methyltransferase complex, which promotes the formation of N(7)-methylguanine in tRNA, mRNA, and miRNA. METTL1 Protein, Human (His) is the recombinant human-derived METTL1 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The METTL1 protein is a catalytic component of the METTL1-WDR4 methyltransferase complex, which promotes the formation of N(7)-methylguanine in tRNA, mRNA, and miRNA. METTL1 Protein, Human (His) is the recombinant human-derived METTL1 protein, expressed by E. coli , with N-His labeled tag.
Background
METTL1, the catalytic component of the METTL1-WDR4 methyltransferase complex, is instrumental in mediating the formation of N(7)-methylguanine in various RNA species, including tRNAs, mRNAs, and microRNAs (miRNAs). Specifically, METTL1 catalyzes the addition of N(7)-methylguanine at position 46 (m7G46) within a significant subset of tRNAs containing the 5'-RAGGU-3' motif in the variable loop. This modification, such as m7G46, stabilizes tRNA tertiary structure and shields tRNAs from decay. METTL1 also serves as a methyltransferase for internal N(7)-methylguanine in mRNAs, particularly in response to stress, leading to the relocalization of methylated mRNAs to stress granules and consequent translational suppression. Furthermore, METTL1 methylates specific miRNAs, including let-7, facilitating let-7 miRNA processing by disrupting inhibitory secondary structures within primary miRNA transcripts. Beyond its role in RNA modification, METTL1 emerges as a regulator of embryonic stem cell self-renewal and differentiation.
Verified Bioactivity
Measured in a cell proliferation assay using HepG2 cells. The ED50 for this effect is 0.5-5.0 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9UBP6-1/NP_005362.3 (D32-Q265)
-
Molecular Construction
-
N-term
-
6*His
-
METTL1 (D32-Q265)
Accession # Q9UBP6-1/NP_005362.3 -
C-term
-
-
Protein Length
Partial
-
Synonyms
METTL1; TRNA (Guanine-N(7)-)-Methyltransferase; Prev. C12orf1; Methyltransferase-Like Protein 1; TRNA (Guanine(46)-N(7))-Methyltransferase; TRNA(M7G46)-Methyltransferase; TRMT8; Methyltransferase Like 1; TRM8; D1075-Like Gene Product; MiRNA (Guanine-N(7)-
-
AA Sequence
DHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQ
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM Tris, 0.5 M NaCl, 20% glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)