METTL1 Protein, Human (His)

The METTL1 protein is a catalytic component of the METTL1-WDR4 methyltransferase complex, which promotes the formation of N(7)-methylguanine in tRNA, mRNA, and miRNA. METTL1 Protein, Human (His) is the recombinant human-derived METTL1 protein, expressed by E. coli , with N-His labeled tag.

METTL1, the catalytic component of the METTL1-WDR4 methyltransferase complex, is instrumental in mediating the formation of N(7)-methylguanine in various RNA species, including tRNAs, mRNAs, and microRNAs (miRNAs). Specifically, METTL1 catalyzes the addition of N(7)-methylguanine at position 46 (m7G46) within a significant subset of tRNAs containing the 5'-RAGGU-3' motif in the variable loop. This modification, such as m7G46, stabilizes tRNA tertiary structure and shields tRNAs from decay. METTL1 also serves as a methyltransferase for internal N(7)-methylguanine in mRNAs, particularly in response to stress, leading to the relocalization of methylated mRNAs to stress granules and consequent translational suppression. Furthermore, METTL1 methylates specific miRNAs, including let-7, facilitating let-7 miRNA processing by disrupting inhibitory secondary structures within primary miRNA transcripts. Beyond its role in RNA modification, METTL1 emerges as a regulator of embryonic stem cell self-renewal and differentiation.

Measured in a cell proliferation assay using HepG2 cells. The ED₅₀ for this effect is 0.5-5.0 ng/mL.

• 
  Measured in a cell proliferation assay using HepG2 cells. The ED₅₀ for this effect is 0.9259 ng/mL , corresponding to a specific activity is 1.080×10⁶ units/mg.

Human

E. coli

N-6*His

Q9UBP6-1/NP_005362.3 (D32-Q265)

4234  [NCBI]

Partial

DHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQ

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 50 mM Tris, 0.5 M NaCl, 20% glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Shipping with dry ice.