METTL1 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

The METTL1 protein is a catalytic component of the METTL1-WDR4 methyltransferase complex, which promotes the formation of N(7)-methylguanine in tRNA, mRNA, and miRNA. METTL1 Protein, Human (His) is the recombinant human-derived METTL1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The METTL1 protein is a catalytic component of the METTL1-WDR4 methyltransferase complex, which promotes the formation of N(7)-methylguanine in tRNA, mRNA, and miRNA. METTL1 Protein, Human (His) is the recombinant human-derived METTL1 protein, expressed by E. coli , with N-His labeled tag.

Background

METTL1, the catalytic component of the METTL1-WDR4 methyltransferase complex, is instrumental in mediating the formation of N(7)-methylguanine in various RNA species, including tRNAs, mRNAs, and microRNAs (miRNAs). Specifically, METTL1 catalyzes the addition of N(7)-methylguanine at position 46 (m7G46) within a significant subset of tRNAs containing the 5'-RAGGU-3' motif in the variable loop. This modification, such as m7G46, stabilizes tRNA tertiary structure and shields tRNAs from decay. METTL1 also serves as a methyltransferase for internal N(7)-methylguanine in mRNAs, particularly in response to stress, leading to the relocalization of methylated mRNAs to stress granules and consequent translational suppression. Furthermore, METTL1 methylates specific miRNAs, including let-7, facilitating let-7 miRNA processing by disrupting inhibitory secondary structures within primary miRNA transcripts. Beyond its role in RNA modification, METTL1 emerges as a regulator of embryonic stem cell self-renewal and differentiation.

Verified Bioactivity

Measured in a cell proliferation assay using HepG2 cells. The ED50 for this effect is 0.5-5.0 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • METTL1 (D32-Q265)
      Accession # Q9UBP6-1/NP_005362.3
    • C-term
  • Protein Length

    Partial

  • Synonyms

    METTL1; TRNA (Guanine-N(7)-)-Methyltransferase; Prev. C12orf1; Methyltransferase-Like Protein 1; TRNA (Guanine(46)-N(7))-Methyltransferase; TRNA(M7G46)-Methyltransferase; TRMT8; Methyltransferase Like 1; TRM8; D1075-Like Gene Product; MiRNA (Guanine-N(7)-

  • AA Sequence

    DHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQ

  • Molecular Weight

    Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris, 0.5 M NaCl, 20% glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00