MIP-3 alpha/CCL20 Protein, Rhesus macaque (GST)
The MIP-3 alpha/CCL20 protein is part of the intercrine beta (CC chemokine) family and helps regulate immune cell migration and inflammation. It is thought to attract and activate dendritic cells and memory T cells, playing a crucial role in immune responses at sites of infection or inflammation. MIP-3 alpha/CCL20 Protein, Rhesus macaque (GST) is the recombinant Rhesus Macaque-derived MIP-3 alpha/CCL20 protein, expressed by E. coli , with N-GST labeled tag.
- Species: Rhesus Macaque
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The MIP-3 alpha/CCL20 protein is part of the intercrine beta (CC chemokine) family and helps regulate immune cell migration and inflammation. It is thought to attract and activate dendritic cells and memory T cells, playing a crucial role in immune responses at sites of infection or inflammation. MIP-3 alpha/CCL20 Protein, Rhesus macaque (GST) is the recombinant Rhesus Macaque-derived MIP-3 alpha/CCL20 protein, expressed by E. coli , with N-GST labeled tag.
Background
The MIP-3 alpha/CCL20 protein belongs to the intercrine beta (chemokine CC) family, a group of chemokines involved in the regulation of immune cell migration and inflammation. This protein is known for its role in attracting and activating immune cells, particularly dendritic cells and memory T cells, to sites of infection or inflammation. MIP-3 alpha/CCL20 functions through binding to its receptor, CCR6, and initiates a cascade of cellular events that promote immune cell recruitment and activation. It plays a crucial role in the immune response against pathogens and is also involved in the development of certain inflammatory diseases. MIP-3 alpha/CCL20 is considered as a potential therapeutic target for modulating immune responses and controlling inflammation in various pathological conditions.
Technical Parameters
-
Species Rhesus Macaque
-
Source E. coli
-
Tag N-GST
-
Accession
Q8HYP6 (A27-M96)
-
Molecular Construction
-
N-term
-
GST
-
CCL20 (A27-M96)
Accession # Q8HYP6 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CCL20; Chemokine (C-C Motif) Ligand 20; Prev. SCYA20; C-C Motif Chemokine 20; LARC; CC Chemokine LARC; MIP-3a; MIP-3-Alpha; ST38; Exodus-1; CKb4; MIP3A; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 20; Beta Chemokine Exodus-1; Liver And Activati
-
AA Sequence
ASNFDCCLRYTDRILHPKFIVGFTQQLANETCDINAVVFHTKKGLSVCANPKQTWVKLIVRRLSKKINKM
-
Predicted Molecular Mass
35.1 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
