MIP-3 alpha/CCL20 Protein, Rhesus macaque (GST)

The MIP-3 alpha/CCL20 protein is part of the intercrine beta (CC chemokine) family and helps regulate immune cell migration and inflammation. It is thought to attract and activate dendritic cells and memory T cells, playing a crucial role in immune responses at sites of infection or inflammation. MIP-3 alpha/CCL20 Protein, Rhesus macaque (GST) is the recombinant Rhesus Macaque-derived MIP-3 alpha/CCL20 protein, expressed by E. coli , with N-GST labeled tag.

The MIP-3 alpha/CCL20 protein belongs to the intercrine beta (chemokine CC) family, a group of chemokines involved in the regulation of immune cell migration and inflammation. This protein is known for its role in attracting and activating immune cells, particularly dendritic cells and memory T cells, to sites of infection or inflammation. MIP-3 alpha/CCL20 functions through binding to its receptor, CCR6, and initiates a cascade of cellular events that promote immune cell recruitment and activation. It plays a crucial role in the immune response against pathogens and is also involved in the development of certain inflammatory diseases. MIP-3 alpha/CCL20 is considered as a potential therapeutic target for modulating immune responses and controlling inflammation in various pathological conditions.

Rhesus Macaque

E. coli

N-GST

Q8HYP6 (A27-M96)

574182  [NCBI]

Full Length of Mature Protein

ASNFDCCLRYTDRILHPKFIVGFTQQLANETCDINAVVFHTKKGLSVCANPKQTWVKLIVRRLSKKINKM

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.