MIP-4/CCL18 Protein, Human (P. pastoris, His)

The MIP-4/CCL18 protein selectively attracts lymphocytes, but not monocytes or granulocytes. It participates in the migration of B cells to follicles in lymph nodes and coordinates immune cell dynamics. MIP-4/CCL18 Protein, Human (P. pastoris, His) is the recombinant human-derived MIP-4/CCL18 protein, expressed by P. pastoris , with N-6*His labeled tag.

MIP-4/CCL18 protein functions as a chemotactic factor with a specific affinity for lymphocytes, excluding monocytes or granulocytes. Its potential involvement in B-cell migration into B-cell follicles within lymph nodes suggests a role in orchestrating the cellular dynamics of immune responses. Furthermore, MIP-4/CCL18 plays a crucial role in attracting naive T-lymphocytes towards dendritic cells and activated macrophages in lymph nodes, exhibiting chemotactic activity for various T-cell subtypes, including naive T-cells, CD4+, and CD8+ T-cells. This broad chemotactic influence positions MIP-4/CCL18 as a potential player in both humoral and cell-mediated immunity responses, underscoring its multifaceted role in modulating immune cell trafficking and interactions within lymphoid tissues.

Human

P. pastoris

N-6*His

P55774 (A21-A89)

6362  [NCBI]

Full Length of Mature Protein

AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.