MIP-4/CCL18 Protein, Human (P. pastoris, His)
The MIP-4/CCL18 protein selectively attracts lymphocytes, but not monocytes or granulocytes. It participates in the migration of B cells to follicles in lymph nodes and coordinates immune cell dynamics. MIP-4/CCL18 Protein, Human (P. pastoris, His) is the recombinant human-derived MIP-4/CCL18 protein, expressed by P. pastoris , with N-6*His labeled tag.
- Species: Human
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The MIP-4/CCL18 protein selectively attracts lymphocytes, but not monocytes or granulocytes. It participates in the migration of B cells to follicles in lymph nodes and coordinates immune cell dynamics. MIP-4/CCL18 Protein, Human (P. pastoris, His) is the recombinant human-derived MIP-4/CCL18 protein, expressed by P. pastoris , with N-6*His labeled tag.
Background
MIP-4/CCL18 protein functions as a chemotactic factor with a specific affinity for lymphocytes, excluding monocytes or granulocytes. Its potential involvement in B-cell migration into B-cell follicles within lymph nodes suggests a role in orchestrating the cellular dynamics of immune responses. Furthermore, MIP-4/CCL18 plays a crucial role in attracting naive T-lymphocytes towards dendritic cells and activated macrophages in lymph nodes, exhibiting chemotactic activity for various T-cell subtypes, including naive T-cells, CD4+, and CD8+ T-cells. This broad chemotactic influence positions MIP-4/CCL18 as a potential player in both humoral and cell-mediated immunity responses, underscoring its multifaceted role in modulating immune cell trafficking and interactions within lymphoid tissues.
Technical Parameters
-
Species Human
-
Source P. pastoris
-
Tag N-6*His
-
Accession
P55774 (A21-A89)
-
Molecular Construction
-
N-term
-
6*His
-
CCL18 (A21-A89)
Accession # P55774 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CCL18; Macrophage Inflammatory Protein 4; Prev. SCYA18; C-C Motif Chemokine 18; DC-CK1; CC Chemokine PARC; AMAC-1; AMAC1; DCCK1; Pulmonary And Activation-Regulated; MIP-4; Chemokine (C-C Motif) Ligand 18; PARC; Small Inducible Cytokine A18; CKb7; Small-In
-
AA Sequence
AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA
-
Predicted Molecular Mass
9.9 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
