MLKL Protein, Human (sf9, His-GST)
Based on 1 Customer Validation
MLKL protein is a pseudokinase that plays a key role in TNF-induced necroptosis. Despite lacking intrinsic kinase activity, it is activated through RIPK3 phosphorylation, leading to homotrimerization, plasma membrane localization, and execution of necroptosis. MLKL, Human (sf9, His-GST) is the recombinant human-derived MLKL protein, expressed by sf9 insect cells, with N-Avi labeled tag.
- Species: Human
- Source: sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MLKL protein is a pseudokinase that plays a key role in TNF-induced necroptosis. Despite lacking intrinsic kinase activity, it is activated through RIPK3 phosphorylation, leading to homotrimerization, plasma membrane localization, and execution of necroptosis. MLKL, Human (sf9, His-GST) is the recombinant human-derived MLKL protein, expressed by sf9 insect cells, with N-Avi labeled tag.
Background
MLKL, a pseudokinase, plays a pivotal role in TNF-induced necroptosis, a programmed cell death process characterized by plasma membrane damage and calcium influx. Despite lacking intrinsic protein kinase activity, MLKL is activated upon phosphorylation by RIPK3. This activation leads to homotrimerization, plasma membrane localization, and execution of necroptosis. Additionally, in response to orthomyxoviruses infection, MLKL can undergo nuclear necroptosis triggered by ZBP1 activation, resulting in disruption of the nuclear envelope and release of cellular DNA into the cytosol. MLKL's necroptotic function is facilitated by its binding to highly phosphorylated inositol phosphates, such as inositolhexakisphosphate (InsP6). This binding not only mediates the release of an N-terminal auto-inhibitory region but also requires RIPK3-dependent phosphorylation for full activation. Necrosulfonamide, a specific inhibitor of necroptosis, targets Cys-86 and effectively inhibits MLKL function.
Technical Parameters
-
Species Human
-
Source sf9 insect cells
-
Tag N-His;N-GST
-
Accession
Q8NB16-1 (E2-K471)
-
Gene ID197259
-
Molecular Construction
-
N-term
-
His-GST
-
(E2-K471)
Accession # Q8NB16-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
MLKL; FLJ34389; Mixed Lineage Kinase Domain Like Pseudokinase; HMLKL; Mixed Lineage Kinase Domain-Like Protein; Mixed Lineage Kinase Domain-Like
-
AA Sequence
ENLKHIITLGQVIHKRCEEMKYCKKQCRRLGHRVLGLIKPLEMLQDQGKRSVPSEKLTTAMNRFKAALEEANGEIEKFSNRSNICRFLTASQDKILFKDVNRKLSDVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNEKIEASLRRLEINMKEIKETLRQYLPPKCMQEIPQEQIKEIKKEQLSGSPWILLRENEVSTLYKGEYHRAPVAIKVFKKLQAGSIAIVRQTFNKEIKTMKKFESPNILRIFGICIDETVTPPQFSIVMEYCELGTLRELLDREKDLTLGKRMVLVLGAARGLYRLHHSEAPELHGKIRSSNFLVTQGYQVKLAGFELRKTQTSMSLGTTREKTDRVKSTAYLSPQELEDVFYQYDVKSEIYSFGIVLWEIATGDIPFQGCNSEKIRKLVAVKRQQEPLGEDCPSELREIIDECRAHDPSVRPSVDEILKKLSTFSK
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 5% glycerol, 5 mM DTT, 0.1 M Trehalose.
Note: If this product is used in SPR assay, please note that the protein buffer should not contain primary amino components (such as Tris and Imidazole), and the buffer needs to be replaced.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
