MMP-16 Protein, Human (I152N, His)
Based on 1 Customer Validation
The MMP-16 protein functions as an endopeptidase capable of degrading various components of the extracellular matrix, particularly type III collagen and fibronectin. Its effects extend to the activation of progelatinase A, which contributes to the dynamic remodeling of the extracellular matrix within blood vessels. MMP-16 Protein, Human (I152N, His) is the recombinant human-derived MMP-16 protein, expressed by E. coli , with C-10*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The MMP-16 protein functions as an endopeptidase capable of degrading various components of the extracellular matrix, particularly type III collagen and fibronectin. Its effects extend to the activation of progelatinase A, which contributes to the dynamic remodeling of the extracellular matrix within blood vessels. MMP-16 Protein, Human (I152N, His) is the recombinant human-derived MMP-16 protein, expressed by E. coli , with C-10*His labeled tag.
Background
MMP-16 (Matrix Metalloproteinase-16) is an endopeptidase pivotal in the degradation of diverse extracellular matrix components, including collagen type III and fibronectin. It demonstrates the ability to activate progelatinase A, contributing to the regulation of matrix remodeling in blood vessels. The short isoform of MMP-16 is particularly notable for its cleavage of fibronectin and collagen type III, albeit at a reduced rate, with no discernible effect on collagen types I, II, IV, and V. However, in the presence of CSPG4, MMP-16 may play a role in the degradation and invasion of type I collagen by melanoma cells. This dual functionality underscores the complex and context-dependent nature of MMP-16's involvement in extracellular matrix dynamics, highlighting its potential implications in physiological and pathological processes, including those associated with vascular remodeling and cancer progression.
Verified Bioactivity
Measured by its ability to cleave a fluorogenic peptide substrate Mca-KPLGL-Dpa-AR-NH2. The specific activity is >250 pmol/min/µg. (Activation description: The proenzyme needs to be activated by Human Furin (HY-P78747) for an activated form.)
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-10*His
-
Accession
P51512 (A32-G291, I152N)
-
Molecular Construction
-
N-term
-
MMP-16 (A32-G291, I152N)
Accession # P51512 -
10*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
MMP16; MMP-X2; Prev. C8orf57; MT3MMP; MT3-MMP; MTMMP3; Matrix Metallopeptidase 16 (Membrane-Inserted); Matrix Metalloproteinase 16 (Membrane-Inserted); Membrane-Type Matrix Metalloproteinase 3; Putative Transmembrane Protein C8orf57; Membrane-Type-3 Matri
-
AA Sequence
ATVCGTEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYALTGQKWQHKHITYSIKNVTPKVGDPETRKANRRAFDVWQNVTPLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG
-
Molecular Weight
Approximately 29 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, 0.4% SKL, 20% glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
