MSRB3 Protein, Human (HEK293, His)

MSRB3 Protein, with a unique ability to catalyze methionine sulfoxide reduction, plays a crucial role in the auditory system. Isoform 2 of MSRB3 is deemed essential for normal hearing, highlighting its significance in auditory function. MSRB3 Protein, Human (HEK293, His) is the recombinant human-derived MSRB3 protein, expressed by HEK293 , with C-His labeled tag.

MSRB3, a protein with the distinctive ability to catalyze the reduction of both free and protein-bound methionine sulfoxide to methionine, stands out for its crucial role in the auditory system. Specifically, isoform 2 of MSRB3 is deemed essential for normal hearing, underscoring its significance in auditory function.

Measured by its ability to through oxidizing DTT. The specific activity is 17261.04 pmoL/min/μg, as measured under the described conditions.

Human

HEK293

C-His

Q8IXL7-2 (G26-D181)

253827  [NCBI]

Partial

GSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQAD

Approximately 19 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.