1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins STE
  4. Serine/Threonine-Protein Kinase 26
  5. MST4/STK26 Protein, Human (Active, sf9, GST)

MST4/STK26 is a kinase that mediates cell growth, regulates apoptosis, and, together with STK24, is involved in negatively affecting Golgi reorientation during RHO-triggered polarized cell migration. MST4/STK26 enhances autophagic flux by phosphorylating ATG4B at 'Ser-383'. MST4/STK26 Protein, Human (sf9, GST) is the recombinant human-derived MST4/STK26 protein, expressed by Sf9 insect cells , with GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MST4/STK26 is a kinase that mediates cell growth, regulates apoptosis, and, together with STK24, is involved in negatively affecting Golgi reorientation during RHO-triggered polarized cell migration. MST4/STK26 enhances autophagic flux by phosphorylating ATG4B at 'Ser-383'. MST4/STK26 Protein, Human (sf9, GST) is the recombinant human-derived MST4/STK26 protein, expressed by Sf9 insect cells , with GST labeled tag.

Background

MST4/STK26, a serine/threonine-protein kinase, functions as a mediator of cell growth and plays a modulatory role in apoptosis. Alongside STK24, it participates in the negative regulation of Golgi reorientation during polarized cell migration triggered by RHO activation. Additionally, MST4/STK26 phosphorylates ATG4B at 'Ser-383,' thereby enhancing autophagic flux. These activities highlight its involvement in diverse cellular processes, including growth regulation, apoptotic modulation, and coordination of cellular migration through Golgi reorientation and autophagy modulation.

Biological Activity

The specific activity was determined to be 15 nmol/min/mg using MBP as substrate.

Species

Human

Source

Sf9 insect cells

Tag

GST

Accession

Q9P289-1 (M1-P416)

Gene ID
Molecular Construction
N-term
GST
MST4 (M1-P416)
Accession # Q9P289-1
C-term
Protein Length

Full Length of Isoform-1

Synonyms
Serine/threonine-protein kinase 26; MST-4; STK26; MASK
AA Sequence

MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLVGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAEGHSDDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADESP

Predicted Molecular Mass
73 kDa
Molecular Weight

Approximately 65 kDa kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM PB, 300 mM NaCl, pH 7.0, 25% glycerol, 0.5 mM TCEP, 0.5 mM EDTA, 0.5 mM GSH.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

MST4/STK26 Protein, Human (Active, sf9, GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MST4/STK26 Protein, Human (Active, sf9, GST)
Cat. No.:
HY-P74741
Quantity:
MCE Japan Authorized Agent: