Copy Link Print Information

MST4/STK26 Protein, Human (Active, sf9, GST)

Customer Review

Based on 1 Customer Validation

MST4/STK26 is a kinase that mediates cell growth, regulates apoptosis, and, together with STK24, is involved in negatively affecting Golgi reorientation during RHO-triggered polarized cell migration. MST4/STK26 enhances autophagic flux by phosphorylating ATG4B at 'Ser-383'. MST4/STK26 Protein, Human (sf9, GST) is the recombinant human-derived MST4/STK26 protein, expressed by Sf9 insect cells , with GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • MST4/STK26 Protein, Human (Active, sf9, GST) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

MST4/STK26 is a kinase that mediates cell growth, regulates apoptosis, and, together with STK24, is involved in negatively affecting Golgi reorientation during RHO-triggered polarized cell migration. MST4/STK26 enhances autophagic flux by phosphorylating ATG4B at 'Ser-383'. MST4/STK26 Protein, Human (sf9, GST) is the recombinant human-derived MST4/STK26 protein, expressed by Sf9 insect cells , with GST labeled tag.

Background

MST4/STK26, a serine/threonine-protein kinase, functions as a mediator of cell growth and plays a modulatory role in apoptosis. Alongside STK24, it participates in the negative regulation of Golgi reorientation during polarized cell migration triggered by RHO activation. Additionally, MST4/STK26 phosphorylates ATG4B at 'Ser-383,' thereby enhancing autophagic flux. These activities highlight its involvement in diverse cellular processes, including growth regulation, apoptotic modulation, and coordination of cellular migration through Golgi reorientation and autophagy modulation.

Verified Bioactivity

The specific activity was determined to be 15 nmol/min/mg using MBP as substrate.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag GST
  • Accession

    Q9P289-1 (M1-P416)

  • Gene ID
    51765  [NCBI]
  • Molecular Construction
    • N-term
    • GST
    • MST4 (M1-P416)
      Accession # Q9P289-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    STK26; Mammalian Ste20-Like Protein Kinase 4; Serine/Threonine Kinase 26; Mammalian STE20-Like Protein Kinase 4; MST4; Serine/Threonine Protein Kinase MST4; MASK; Serine/Threonine Protein Kinase 26; Serine/Threonine-Protein Kinase MASK; Mst3 And SOK1-Rela

  • AA Sequence

    MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLVGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAEGHSDDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADESP

  • Predicted Molecular Mass

    73 kDa

  • Molecular Weight

    Approximately 65 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM PB, 300 mM NaCl, pH 7.0, 25% glycerol, 0.5 mM TCEP, 0.5 mM EDTA, 0.5 mM GSH.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • MST4/STK26 Protein, Human (Active, sf9, GST) Product Image
    1/16
  • MST4/STK26 Protein, Human (Active, sf9, GST) Product Image