MSTN Protein, Cat (HEK293, His)
Based on 1 Customer Validation
MSTN (Myostatin) serves as a dedicated negative regulator of skeletal muscle growth, forming homodimers through disulfide linkages. It inhibits WFIKKN2 activity through interaction and further contributes to its role in negatively modulating skeletal muscle growth by engaging with FSTL3. MSTN Protein, Cat (HEK293, His) is the recombinant cat-derived MSTN protein, expressed by HEK293 , with N-10*His labeled tag.
- Species: Cat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MSTN (Myostatin) serves as a dedicated negative regulator of skeletal muscle growth, forming homodimers through disulfide linkages. It inhibits WFIKKN2 activity through interaction and further contributes to its role in negatively modulating skeletal muscle growth by engaging with FSTL3. MSTN Protein, Cat (HEK293, His) is the recombinant cat-derived MSTN protein, expressed by HEK293 , with N-10*His labeled tag.
Background
MSTN (Myostatin) functions as a dedicated negative regulator of skeletal muscle growth, forming homodimers through disulfide linkages. It interacts with WFIKKN2, effectively inhibiting the activity of WFIKKN2. Additionally, MSTN engages with FSTL3, further contributing to its role in negatively modulating skeletal muscle growth.
Technical Parameters
-
Species Cat
-
Source HEK293
-
Tag N-10*His
-
Accession
M3WPT7 (G19-S375)
-
Molecular Construction
-
N-term
-
10*His
-
MSTN (G19-S375)
Accession # M3WPT7 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
MSTN; GDF-8; Prev. GDF8; Myostatin-B; Growth/Differentiation Factor 8; MSLHP; Myostatin; Growth Differentiation Factor 8
-
AA Sequence
GPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDAIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDLLMQVEGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVKTPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
-
Predicted Molecular Mass
44.2 kDa
-
Molecular Weight
Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
