1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. MTH1 Protein, Human (His)

The MTH1 protein functions as an oxidative purine nucleoside triphosphohydrolase and is essential for the protection of cellular nucleotide pools. It catalyzes the hydrolysis of oxidized purine nucleoside triphosphates (such as 2-oxo-dATP and 8-oxo-dGTP), preventing their incorporation into DNA and avoiding base pair transversions. MTH1 Protein, Human (His) is the recombinant human-derived MTH1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The MTH1 protein functions as an oxidative purine nucleoside triphosphohydrolase and is essential for the protection of cellular nucleotide pools. It catalyzes the hydrolysis of oxidized purine nucleoside triphosphates (such as 2-oxo-dATP and 8-oxo-dGTP), preventing their incorporation into DNA and avoiding base pair transversions. MTH1 Protein, Human (His) is the recombinant human-derived MTH1 protein, expressed by E. coli , with N-His labeled tag.

Background

MTH1 Protein functions as an oxidized purine nucleoside triphosphate hydrolase, playing a crucial role in maintaining the integrity of the cellular nucleotide pool. This enzyme catalyzes the hydrolysis of various oxidized purine nucleoside triphosphates, including 2-oxo-dATP, 2-oxo-ATP, 8-oxo-dGTP, and 8-oxo-dATP, preventing their incorporation into DNA and thereby safeguarding against transversions in DNA base pairs. Additionally, MTH1 prevents the integration of methylated purine nucleoside triphosphates into DNA, contributing to its antimutagenic activity and protecting cells from the deleterious effects of oxidative stress. The multifaceted hydrolase activity of MTH1 underscores its significance in preserving genomic stability and mitigating the impact of oxidative damage on cellular processes.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-His

Accession

P36639-4/NP_002443.3 (M1-V156)

Gene ID
Molecular Construction
N-term
His
MTH1 (M1-V156)
Accession # P36639-4/NP_002443.3
C-term
Protein Length

Full Length of Isoform-4

Synonyms
Oxidized purine nucleoside triphosphate hydrolase; Nudix motif 1; NUDT1; MTH1
AA Sequence

MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV

Molecular Weight

Approximately 20.2 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 100 mM NaCl, pH 8.0. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MTH1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

MTH1 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MTH1 Protein, Human (His)
Cat. No.:
HY-P74740
Quantity:
MCE Japan Authorized Agent: