Copy Link Print Information

MTH1 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

The MTH1 protein functions as an oxidative purine nucleoside triphosphohydrolase and is essential for the protection of cellular nucleotide pools. It catalyzes the hydrolysis of oxidized purine nucleoside triphosphates (such as 2-oxo-dATP and 8-oxo-dGTP), preventing their incorporation into DNA and avoiding base pair transversions. MTH1 Protein, Human (His) is the recombinant human-derived MTH1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • MTH1 Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The MTH1 protein functions as an oxidative purine nucleoside triphosphohydrolase and is essential for the protection of cellular nucleotide pools. It catalyzes the hydrolysis of oxidized purine nucleoside triphosphates (such as 2-oxo-dATP and 8-oxo-dGTP), preventing their incorporation into DNA and avoiding base pair transversions. MTH1 Protein, Human (His) is the recombinant human-derived MTH1 protein, expressed by E. coli , with N-His labeled tag.

Background

MTH1 Protein functions as an oxidized purine nucleoside triphosphate hydrolase, playing a crucial role in maintaining the integrity of the cellular nucleotide pool. This enzyme catalyzes the hydrolysis of various oxidized purine nucleoside triphosphates, including 2-oxo-dATP, 2-oxo-ATP, 8-oxo-dGTP, and 8-oxo-dATP, preventing their incorporation into DNA and thereby safeguarding against transversions in DNA base pairs. Additionally, MTH1 prevents the integration of methylated purine nucleoside triphosphates into DNA, contributing to its antimutagenic activity and protecting cells from the deleterious effects of oxidative stress. The multifaceted hydrolase activity of MTH1 underscores its significance in preserving genomic stability and mitigating the impact of oxidative damage on cellular processes.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His
  • Accession

    P36639-4/NP_002443.3 (M1-V156)

  • Gene ID
    4521  [NCBI]
  • Molecular Construction
    • N-term
    • His
    • MTH1 (M1-V156)
      Accession # P36639-4/NP_002443.3
    • C-term
  • Protein Length

    Full Length of Isoform-4

  • Synonyms

    NUDT1; Methylated Purine Nucleoside Triphosphate Hydrolase; Prev. MTH1; 8-Oxo-7,8-Dihydrodeoxyguanosine Triphosphatase; 7,8-Dihydro-8-Oxoguanine Triphosphatase; Nucleoside Diphosphate-Linked Moiety X Motif 1; Nudix Motif 1; 8-Oxo-7,8-Dihydroguanosine Trip

  • AA Sequence

    MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV

  • Molecular Weight

    Approximately 20.2 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 100 mM NaCl, pH 8.0. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • MTH1 Protein, Human (His) Product Image
    1/16
  • MTH1 Protein, Human (His) Product Image