MTH1 Protein, Human (His)
Based on 1 Customer Validation
The MTH1 protein functions as an oxidative purine nucleoside triphosphohydrolase and is essential for the protection of cellular nucleotide pools. It catalyzes the hydrolysis of oxidized purine nucleoside triphosphates (such as 2-oxo-dATP and 8-oxo-dGTP), preventing their incorporation into DNA and avoiding base pair transversions. MTH1 Protein, Human (His) is the recombinant human-derived MTH1 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The MTH1 protein functions as an oxidative purine nucleoside triphosphohydrolase and is essential for the protection of cellular nucleotide pools. It catalyzes the hydrolysis of oxidized purine nucleoside triphosphates (such as 2-oxo-dATP and 8-oxo-dGTP), preventing their incorporation into DNA and avoiding base pair transversions. MTH1 Protein, Human (His) is the recombinant human-derived MTH1 protein, expressed by E. coli , with N-His labeled tag.
MTH1 Protein functions as an oxidized purine nucleoside triphosphate hydrolase, playing a crucial role in maintaining the integrity of the cellular nucleotide pool. This enzyme catalyzes the hydrolysis of various oxidized purine nucleoside triphosphates, including 2-oxo-dATP, 2-oxo-ATP, 8-oxo-dGTP, and 8-oxo-dATP, preventing their incorporation into DNA and thereby safeguarding against transversions in DNA base pairs. Additionally, MTH1 prevents the integration of methylated purine nucleoside triphosphates into DNA, contributing to its antimutagenic activity and protecting cells from the deleterious effects of oxidative stress. The multifaceted hydrolase activity of MTH1 underscores its significance in preserving genomic stability and mitigating the impact of oxidative damage on cellular processes.
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P36639-4/NP_002443.3 (M1-V156)
-
Molecular Construction
-
N-term
-
His
-
MTH1 (M1-V156)
Accession # P36639-4/NP_002443.3 -
C-term
-
-
Protein Length
Full Length of Isoform-4
-
Synonyms
NUDT1; Methylated Purine Nucleoside Triphosphate Hydrolase; Prev. MTH1; 8-Oxo-7,8-Dihydrodeoxyguanosine Triphosphatase; 7,8-Dihydro-8-Oxoguanine Triphosphatase; Nucleoside Diphosphate-Linked Moiety X Motif 1; Nudix Motif 1; 8-Oxo-7,8-Dihydroguanosine Trip
-
AA Sequence
MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
-
Molecular Weight
Approximately 20.2 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 100 mM NaCl, pH 8.0. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
