Myoglobin Protein, Human (His)

Myoglobin Protein, a globin family member, reserves oxygen and facilitates its movement in muscles. Myoglobin Protein, Human (His) is the recombinant human-derived Myoglobin protein, expressed by E. coli , with C-6*His labeled tag. The total length of Myoglobin Protein, Human (His) is 154 a.a., with molecular weight of ~18.0 kDa.

Myoglobin, a member of the globin family, functions as a reserve supply of oxygen and plays a crucial role in facilitating the movement of oxygen within muscles.

Human

E. coli

C-6*His

P02144 (M1-G154)

4151  [NCBI]

MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG

Approximately 18.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 200 mM NaCl,1 mM DTT, 20% glycerol, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.