Myoglobin Protein, Human (His)
Based on 1 Customer Validation
Myoglobin Protein, a globin family member, reserves oxygen and facilitates its movement in muscles. Myoglobin Protein, Human (His) is the recombinant human-derived Myoglobin protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Myoglobin Protein, a globin family member, reserves oxygen and facilitates its movement in muscles. Myoglobin Protein, Human (His) is the recombinant human-derived Myoglobin protein, expressed by E. coli , with C-6*His labeled tag.
Background
Myoglobin, a member of the globin family, functions as a reserve supply of oxygen and plays a crucial role in facilitating the movement of oxygen within muscles.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P02144 (M1-G154)
-
Molecular Construction
-
N-term
-
Myoglobin (M1-G154)
Accession # P02144 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
MB; Nitrite Reductase MB; Myoglobin; Pseudoperoxidase MB; PVALB; MYOSB
-
AA Sequence
MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
-
Predicted Molecular Mass
18 kDa
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 200 mM NaCl,1 mM DTT, 20% glycerol, pH 8.0 or PBS, 350 mM NaCl, 5% Trehalose, 5% Mannitol, 0.02% Tween 80, 1mM EDTA, pH7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (233 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
