Nectin-2/CD112 Protein, Human (Biotinylated, HEK293, His-Avi)
Nectin-2/CD112 protein has dual roles in T-cell signaling: as a costimulator with CD226, promoting proliferation and cytokine production, and as a coinhibitor with PVRIG, inhibiting proliferation. It also acts as a cell adhesion protein and a receptor for certain viruses. Nectin-2/CD112 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived Nectin-2/CD112 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Nectin-2/CD112 protein has dual roles in T-cell signaling: as a costimulator with CD226, promoting proliferation and cytokine production, and as a coinhibitor with PVRIG, inhibiting proliferation. It also acts as a cell adhesion protein and a receptor for certain viruses. Nectin-2/CD112 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived Nectin-2/CD112 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.
Background
Nectin-2/CD112, a versatile modulator of T-cell signaling, exhibits dual roles as a costimulator or coinhibitor, contingent upon the receptor it engages. Binding to CD226 prompts the stimulation of T-cell proliferation and cytokine production, including key players like IL2, IL5, IL10, IL13, and IFNG. In contrast, interaction with PVRIG results in the inhibition of T-cell proliferation, and these engagements are competitive in nature. Additionally, Nectin-2/CD112 serves as a probable cell adhesion protein, as indicated in previous studies. Furthermore, in the context of microbial infection, it acts as a receptor for herpes simplex virus 1 (HHV-1) mutant Rid1, herpes simplex virus 1 (HHV-2), and pseudorabies virus (PRV).
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-6*His
-
Accession
Q92692-2 (Q32-L360)
-
Molecular Construction
-
N-term
-
CD112 (Q32-L360)
Accession # Q92692-2 -
6*His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
NECTIN2; Poliovirus Receptor-Related 2 (Herpesvirus Entry Mediator B); Prev. PVRL2; Herpes Virus Entry Mediator B; Prev. HVEB; Herpesvirus Entry Mediator B; Nectin-2; Herpesvirus Entry Protein B; PRR2; Poliovirus Receptor-Like 2; PVRR2; CD112 Antigen; CD1
-
AA Sequence
QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPRASPRDVGPL
-
Predicted Molecular Mass
38.4 kDa
-
Molecular Weight
Approximately 45-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)