Nectin-2/CD112 Protein, Human (Biotinylated, HEK293, His-Avi)

Nectin-2/CD112 protein has dual roles in T-cell signaling: as a costimulator with CD226, promoting proliferation and cytokine production, and as a coinhibitor with PVRIG, inhibiting proliferation. It also acts as a cell adhesion protein and a receptor for certain viruses. Nectin-2/CD112 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived Nectin-2/CD112 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag. The total length of Nectin-2/CD112 Protein, Human (Biotinylated, HEK293, His-Avi) is 329 a.a., with molecular weight of 45-60 kDa.

Nectin-2/CD112, a versatile modulator of T-cell signaling, exhibits dual roles as a costimulator or coinhibitor, contingent upon the receptor it engages. Binding to CD226 prompts the stimulation of T-cell proliferation and cytokine production, including key players like IL2, IL5, IL10, IL13, and IFNG. In contrast, interaction with PVRIG results in the inhibition of T-cell proliferation, and these engagements are competitive in nature. Additionally, Nectin-2/CD112 serves as a probable cell adhesion protein, as indicated in previous studies. Furthermore, in the context of microbial infection, it acts as a receptor for herpes simplex virus 1 (HHV-1) mutant Rid1, herpes simplex virus 1 (HHV-2), and pseudorabies virus (PRV).

Human

HEK293

C-Avi;C-6*His

Q92692-2 (Q32-L360)

5819  [NCBI]

QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPRASPRDVGP

45-60 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.