NEDD8 Protein, Human

Customer Review

Based on 1 Customer Validation

NEDD8 is an important ubiquitin-like protein that plays a key role in cell cycle regulation and embryogenesis by binding to specific proteins such as cullin and p53/TP53. Its binding to cullin is critical for recruiting E2 enzymes to the cullin-RING-based E3 ubiquitin-protein ligase complex, thereby enabling degradation of regulatory proteins. NEDD8 Protein, Human is the recombinant human-derived NEDD8 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

NEDD8 is an important ubiquitin-like protein that plays a key role in cell cycle regulation and embryogenesis by binding to specific proteins such as cullin and p53/TP53. Its binding to cullin is critical for recruiting E2 enzymes to the cullin-RING-based E3 ubiquitin-protein ligase complex, thereby enabling degradation of regulatory proteins. NEDD8 Protein, Human is the recombinant human-derived NEDD8 protein, expressed by E. coli , with tag free.

Background

NEDD8, an ubiquitin-like protein, assumes a pivotal role in regulating cell cycle progression and embryogenesis by conjugating to a select group of cellular proteins, including cullins and p53/TP53. The attachment of NEDD8 to cullins is essential for recruiting the E2 enzyme to the cullin-RING-based E3 ubiquitin-protein ligase complex, facilitating the polyubiquitination and subsequent proteasomal degradation of regulatory proteins such as cyclins. In the case of p53/TP53, NEDD8 conjugation inhibits its transcriptional activity. This covalent attachment process relies on prior activation by the E1 complex UBE1C-APPBP1 and linkage to the E2 enzyme UBE2M. NEDD8 also engages in direct interactions with AHR and NUB1, further expanding its regulatory network.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • NEDD8 (M1-G76)
      Accession # Q15843
    • C-term
  • Protein Length

    Partial

  • Synonyms

    NEDD8; Neddylin; NEDD8 Ubiquitin Like Modifier; Neural Precursor Cell Expressed Developmentally Down-Regulated Protein 8; Nedd-8; Neural Cell Expressed Developmentally Down-Regulated Protein 8; Neural Precursor Cell Expressed, Developmentally Down-Regulat

  • AA Sequence

    MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG

  • Predicted Molecular Mass

    8.6 kDa

  • Molecular Weight

    Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 250 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00