NEDD8 Protein, Human
Based on 1 Customer Validation
NEDD8 is an important ubiquitin-like protein that plays a key role in cell cycle regulation and embryogenesis by binding to specific proteins such as cullin and p53/TP53. Its binding to cullin is critical for recruiting E2 enzymes to the cullin-RING-based E3 ubiquitin-protein ligase complex, thereby enabling degradation of regulatory proteins. NEDD8 Protein, Human is the recombinant human-derived NEDD8 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
NEDD8 is an important ubiquitin-like protein that plays a key role in cell cycle regulation and embryogenesis by binding to specific proteins such as cullin and p53/TP53. Its binding to cullin is critical for recruiting E2 enzymes to the cullin-RING-based E3 ubiquitin-protein ligase complex, thereby enabling degradation of regulatory proteins. NEDD8 Protein, Human is the recombinant human-derived NEDD8 protein, expressed by E. coli , with tag free.
Background
NEDD8, an ubiquitin-like protein, assumes a pivotal role in regulating cell cycle progression and embryogenesis by conjugating to a select group of cellular proteins, including cullins and p53/TP53. The attachment of NEDD8 to cullins is essential for recruiting the E2 enzyme to the cullin-RING-based E3 ubiquitin-protein ligase complex, facilitating the polyubiquitination and subsequent proteasomal degradation of regulatory proteins such as cyclins. In the case of p53/TP53, NEDD8 conjugation inhibits its transcriptional activity. This covalent attachment process relies on prior activation by the E1 complex UBE1C-APPBP1 and linkage to the E2 enzyme UBE2M. NEDD8 also engages in direct interactions with AHR and NUB1, further expanding its regulatory network.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q15843 (M1-G76)
-
Molecular Construction
-
N-term
-
NEDD8 (M1-G76)
Accession # Q15843 -
C-term
-
-
Protein Length
Full Length of Ubiquitin-like protein NEDD8 Chain
-
Synonyms
NEDD8; Neddylin; NEDD8 Ubiquitin Like Modifier; Neural Precursor Cell Expressed Developmentally Down-Regulated Protein 8; Nedd-8; Neural Cell Expressed Developmentally Down-Regulated Protein 8; Neural Precursor Cell Expressed, Developmentally Down-Regulat
-
AA Sequence
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG
-
Predicted Molecular Mass
8.6 kDa
-
Molecular Weight
Approximately 9 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 250 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)