Niemann Pick C2/NPC2 Protein, Mouse (HEK293, His)

Niemann Pick C2/NPC2 Protein, a lysosomal protein, plays a critical role in cholesterol trafficking and lipid metabolism. It facilitates the transport of cholesterol from lysosomes to other cellular compartments. Understanding the functions of NPC2 Protein is vital for studying lipid disorders and developing therapeutic strategies targeting abnormal cholesterol metabolism. Niemann Pick C2/NPC2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Niemann Pick C2/NPC2 protein, expressed by HEK293 , with C-His labeled tag.

Niemann Pick C2 (NPC2) functions as an intracellular cholesterol transporter, collaborating with NPC1 to facilitate the efflux of cholesterol from lysosomal compartments. Upon the release of unesterified cholesterol from LDLs within late endosomes/lysosomes, NPC2 plays a crucial role by transferring cholesterol to the cholesterol-binding pocket in the N-terminal domain of NPC1. Notably, NPC2 exhibits a 1:1 stoichiometry in binding cholesterol and demonstrates the capacity to bind various sterols, such as lathosterol, desmosterol, and plant sterols like stigmasterol and beta-sitosterol. Moreover, the secreted form of NPC2 contributes to the regulation of biliary cholesterol secretion, exerting its influence through the stimulation of ABCG5/ABCG8-mediated cholesterol transport.

Mouse

HEK293

C-His

Q9Z0J0 (E20-S149)

67963  [NCBI]

Full Length of Mature Protein

EPLHFKDCGSKVGVIKEVNVSPCPTDPCQLHKGQSYSVNITFTSGTQSQNSTALVHGILEGIRVPFPIPEPDGCKSGINCPIQKDKVYSYLNKLPVKNEYPSIKLVVEWKLEDDKKNNLFCWEIPVQITS

Approximately 15.9-19 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.