Nitroreductase Protein, B. subtilis (His)
Based on 1 Customer Validation
Nitroreductase is an enzyme that reduces nitro groups on substrates to amino groups. Nitroreductase plays a role in the bioactivation of prodrugs particularly in applications related to cancer therapeutic strategies. Nitroreductase Protein, B. subtilis (His) is the recombinant Nitroreductase protein, expressed by E. coli, with His tag.
- Species: Others
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
Nitroreductase is an enzyme that reduces nitro groups on substrates to amino groups. Nitroreductase plays a role in the bioactivation of prodrugs particularly in applications related to cancer therapeutic strategies. Nitroreductase Protein, B. subtilis (His) is the recombinant Nitroreductase protein, expressed by E. coli, with His tag[1][2].
Background
Nitroreductase is an enzyme that reduces nitro groups on substrates to amino groups and has a molecular mass of approximately 24 kDa. Nitroreductase is expressed mainly in bacterial species. Nitroreductase has functions in cellular processes involving redox reactions. Nitroreductase participates in the breakdown of nitroaromatic compounds which is critical for the detoxification of these potentially harmful substances. Nitroreductase is involved in the drug metabolism pathway specifically under the xenobiotic degradation category. Nitroreductase has the ability to transform prodrugs to active cytotoxic compounds, which makes it significant in research for targeted cancer treatments. Clinical strategies often focus on exploiting Nitroreductase to selectively activate therapeutics within cancer cells. Additionally, nitroreductase's activity influences the nitrogen cycle partnering with proteins like flavin reductase in biochemical reactions[1][2].
In Vitro
Nitroreductase Protein, B. subtilis (His) has an affinity to CB1954 (HY-13543), but the reaction occurs slowly[1].
Nitroreductase Protein, B. subtilis (His) is found to biotransform TNT to the product 2-amino 4,6-DNT[1].
Nitroreductase Protein, B. subtilis (His) reduces both CB1954 and Menadione (HY-B0332) in the presence of NADH and NADPH[2].
Nitroreductase Protein, B. subtilis (His) produces 4-hydroxylamine derivative of CB1954[2].
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag His
-
Accession
P96707 (M1-K212)
-
Gene ID938001
-
Protein Length
Full Length
-
Synonyms
ydgI; BSU05660; Putative NAD; PH nitroreductase YdgI; EC 1.-.-.-; Putative NAD(P)H nitroreductase YdgI; Bacillus subtilis (strain 168); Oxidoreductase
-
AA Sequence
MIKTNDFMEIMKGRRSIRNYDPAVKISKEEMTEILEEATTAPSSVNAQPWRFLVIDSPEGKEKLAPLASFNQTQVTTSSAVIAVFADMNNADYLEEIYSKAVELGYMPQEVKDRQIAALTAHFEKLPAQVNRETILIDGGLVSMQLMLTARAHGYDTNPIGGYDKENIAETFGLDKERYVPVMLLSIGKAADEGYASYRLPIDTIAEWK
-
Predicted Molecular Mass
26.1 kDa
-
Molecular Weight
Approximately 26 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 5% glycerol, 1 mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
References
[1]. Tuşar Demir FR, et al. Cloning, purification and possible use of a Bacillus nitroreductase in biotechnological applications. Sci Rep. 2026 May 5. [Content Brief]
[2]. Emptage CD, et al. Nitroreductase from Bacillus licheniformis: a stable enzyme for prodrug activation. Biochem Pharmacol. 2009 Jan 1;77(1):21-9. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
