NKG2D/CD314 Protein, Mouse (HEK293, His)

The NKG2D/CD314 protein activates and stimulates the innate immune response of NK cells by binding to stress-inducing ligands on tumor and virus-infected cells.It also acts as a costimulatory receptor for TCR, enhancing T cell activation and eliminating tumor cells.NKG2D/CD314 Protein, Mouse (HEK293, His) is the recombinant mouse-derived NKG2D/CD314 protein, expressed by HEK293 , with N-6*His labeled tag.

NKG2D/CD314 Protein functions as an activating and costimulatory receptor critical for immunosurveillance, binding to stress-inducible ligands on autologous tumor cells and virus-infected cells. This engagement triggers stimulatory and costimulatory innate immune responses in activated killer (NK) cells, leading to cytotoxic activity. In CD8(+) T-cell-mediated adaptive immune responses, NKG2D acts as a costimulatory receptor for the T-cell receptor (TCR), amplifying T-cell activation and stimulating perforin-mediated elimination of ligand-expressing tumor cells. Signaling involves calcium influx, culminating in TNF-alpha expression. NKG2D participates in NK cell-mediated bone marrow graft rejection and may regulate NK cell differentiation and survival. The protein forms a homodimer through disulfide linkage and a heterohexamer with HCST/DAP10, crucial for NK cell surface expression and induction of cytotoxicity. It interacts with various ligands, including RAET1A, RAET1B, RAET1C, RAET1D, RAET1E, H60, and MULT1, belonging to MHC class I-related glycoproteins subfamilies. Additionally, NKG2D interacts with CEACAM1, recruiting PTPN6 for VAV1 dephosphorylation, highlighting its role in orchestrating complex immune responses.

Measured by its binding ability in a functional ELISA. Immobilized Mouse CD314 at 4 μg/mL (100 μL/well) can bind biotinylated Rae-1 gamma. The ED₅₀ for this effect is 68.86-82.59 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Mouse CD314 at 4 μg/mL (100μL/well) can bind biotinylated Rae-1 gamma. The ED₅₀ for this effect is 68.86 ng/mL.

Mouse

HEK293

N-6*His

O54709 (F94-V232)

27007  [NCBI]

Extracellular Domain

FQPVLCNKEVPVSSREGYCGPCPNNWICHRNNCYQFFNEEKTWNQSQASCLSQNSSLLKIYSKEEQDFLKLVKSYHWMGLVQIPANGSWQWEDGSSLSYNQLTLVEIPKGSCAVYGSSFKAYTEDCANLNTYICMKRAV

Approximately 20-35 kDa due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/te-9-cell.html