NKG2DL2 Protein, Human (HEK293, His)

NKG2DL2 Protein activates KLRK1/NKG2D receptor, promoting natural killer cell cytotoxicity. Importantly, it does not bind beta2-microglobulin, confirmed by research findings. NKG2DL2 Protein, Human (HEK293, His) is the recombinant human-derived NKG2DL2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of NKG2DL2 Protein, Human (HEK293, His) is 192 a.a., with molecular weight of ~30.0 kDa.

The NKG2DL2 protein functions by binding to and activating the KLRK1/NKG2D receptor, thereby facilitating natural killer cell cytotoxicity. Its interaction with KLRK1/NKG2D has been documented. Notably, this protein does not exhibit binding affinity to beta2-microglobulin, as indicated by research findings.

Human

HEK293

C-6*His

Q9BZM5 (G26-S217)

80328  [NCBI]

GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSS

Approximately 30.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.