NKG2DL2 Protein, Human (HEK293, His)
Based on 1 Customer Validation
NKG2DL2 Protein activates KLRK1/NKG2D receptor, promoting natural killer cell cytotoxicity. Importantly, it does not bind beta2-microglobulin, confirmed by research findings. NKG2DL2 Protein, Human (HEK293, His) is the recombinant human-derived NKG2DL2 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
NKG2DL2 Protein activates KLRK1/NKG2D receptor, promoting natural killer cell cytotoxicity. Importantly, it does not bind beta2-microglobulin, confirmed by research findings. NKG2DL2 Protein, Human (HEK293, His) is the recombinant human-derived NKG2DL2 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
The NKG2DL2 protein functions by binding to and activating the KLRK1/NKG2D receptor, thereby facilitating natural killer cell cytotoxicity. Its interaction with KLRK1/NKG2D has been documented. Notably, this protein does not exhibit binding affinity to beta2-microglobulin, as indicated by research findings.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9BZM5 (G26-S217)
-
Molecular Construction
-
N-term
-
NKG2DL2 (G26-S217)
Accession # Q9BZM5 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
ULBP2; UL16 Binding Protein 2; RAET1H; Retinoic Acid Early Transcript 1H; UL16-Binding Protein 2; NKG2D Ligand 2; ALCAN-Alpha; NKG2DL2; N2DL2; N2DL-2
-
AA Sequence
GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSS
-
Predicted Molecular Mass
22.8 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
