NKp30/NCR3 Protein, Human (HEK293, His-Avi)

NKp30/NCR3 protein is a cell membrane receptor on NK cells and is activated by binding to ligands such as BAG6 and NCR3LG1. This activation enhances NK cell cytotoxicity against neighboring cells that produce these ligands, including tumor cells. NKp30/NCR3 Protein, Human (HEK293, His-Avi) is the recombinant human-derived NKp30/NCR3 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

NKp30/NCR3 protein is a cell membrane receptor on NK cells and is activated by binding to ligands such as BAG6 and NCR3LG1. This activation enhances NK cell cytotoxicity against neighboring cells that produce these ligands, including tumor cells. NKp30/NCR3 Protein, Human (HEK293, His-Avi) is the recombinant human-derived NKp30/NCR3 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

The NKp30/NCR3 protein serves as a cell membrane receptor on natural killer (NK) cells, becoming activated upon binding to extracellular ligands such as BAG6 and NCR3LG1. This activation stimulates NK cell cytotoxicity directed towards neighboring cells producing these ligands, thereby controlling NK cell cytotoxicity against various targets, including tumor cells. The engagement of NCR3 by BAG6 not only enhances NK cell-mediated killing of myeloid dendritic cells (DCs) that did not acquire a mature phenotype but also induces the release of TNFA and IFNG by NK cells. This, in turn, promotes the maturation of myeloid dendritic cells. In its unliganded form, NKp30/NCR3 exists as a homodimer and interacts with CD3Z, NCR3LG1, and BAG6, highlighting its role as a multifaceted regulator in immune responses and NK cell-mediated cytotoxicity.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • NKp30 (L19-T138)
      Accession # O14931-1
    • 8*His-Avi
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    NCR3; Activating Natural Killer Receptor P30; Prev. LY117; NK-P30; NKp30; Activating NK-A1 Receptor; 1C7; CD337 Antigen; Natural Killer Cell P30-Related Protein; MALS; CD337; Natural Cytotoxicity Triggering Receptor 3; Lymphocyte Antigen 117

  • AA Sequence

    LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGT

  • Predicted Molecular Mass

    20 kDa

  • Molecular Weight

    Approximately 26-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00