NKp46/NCR1 Protein, Human (HEK293, mFc)

NKp46/NCR1 protein, a cytotoxicity-activating receptor on natural killer (NK) cells, potentially enhances their efficacy in tumor cell lysis. Interacting with CD247 and FCER1G, NKp46/NCR1 plays a pivotal role in signaling pathways associated with NK cell activation and cytotoxicity. It contributes to the regulatory network for recognizing and eliminating target cells, emphasizing its importance in immune surveillance and anti-tumor responses. NKp46/NCR1 Protein, Human (HEK293, mFc) is the recombinant human-derived NKp46/NCR1 protein, expressed by HEK293 , with C-mFc labeled tag.

The NKp46/NCR1 protein serves as a cytotoxicity-activating receptor, potentially enhancing the efficacy of activated natural killer (NK) cells in mediating the lysis of tumor cells. This receptor interacts with CD247 and FCER1G, playing a pivotal role in the signaling pathways associated with NK cell activation and cytotoxicity against target cells. NKp46/NCR1 contributes to the intricate regulatory network involved in the recognition and elimination of target cells by activated NK cells, highlighting its importance in immune surveillance and anti-tumor responses.

Human

HEK293

C-mFc

O76036-1 (Q22-N255)

9437  [NCBI]

Partial

QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVQFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQN

Approximately 65-75 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.