NKp46/NCR1 Protein, Human (HEK293, mFc)
NKp46/NCR1 protein, a cytotoxicity-activating receptor on natural killer (NK) cells, potentially enhances their efficacy in tumor cell lysis. Interacting with CD247 and FCER1G, NKp46/NCR1 plays a pivotal role in signaling pathways associated with NK cell activation and cytotoxicity. It contributes to the regulatory network for recognizing and eliminating target cells, emphasizing its importance in immune surveillance and anti-tumor responses. NKp46/NCR1 Protein, Human (HEK293, mFc) is the recombinant human-derived NKp46/NCR1 protein, expressed by HEK293 , with C-mFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
NKp46/NCR1 protein, a cytotoxicity-activating receptor on natural killer (NK) cells, potentially enhances their efficacy in tumor cell lysis. Interacting with CD247 and FCER1G, NKp46/NCR1 plays a pivotal role in signaling pathways associated with NK cell activation and cytotoxicity. It contributes to the regulatory network for recognizing and eliminating target cells, emphasizing its importance in immune surveillance and anti-tumor responses. NKp46/NCR1 Protein, Human (HEK293, mFc) is the recombinant human-derived NKp46/NCR1 protein, expressed by HEK293 , with C-mFc labeled tag.
Background
The NKp46/NCR1 protein serves as a cytotoxicity-activating receptor, potentially enhancing the efficacy of activated natural killer (NK) cells in mediating the lysis of tumor cells. This receptor interacts with CD247 and FCER1G, playing a pivotal role in the signaling pathways associated with NK cell activation and cytotoxicity against target cells. NKp46/NCR1 contributes to the intricate regulatory network involved in the recognition and elimination of target cells by activated NK cells, highlighting its importance in immune surveillance and anti-tumor responses.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-mFc
-
Accession
O76036-1 (Q22-N255)
-
Molecular Construction
-
N-term
-
NKp46 (Q22-N255)
Accession # O76036-1 -
mFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
NCR1; NK Cell-Activating Receptor; Prev. LY94; Lymphocyte Antigen 94 Homolog (Activating NK-Receptor; NK-P46); NK-P46; Lymphocyte Antigen 94 Homolog; Natural Killer Cell P46-Related Protein; CD335 Antigen; NKP46; HNKp46; CD335; NKp46; Natural Cytotoxicity
-
AA Sequence
QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVQFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQN
-
Predicted Molecular Mass
52.9 kDa
-
Molecular Weight
Approximately 65-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
