1. Recombinant Proteins
  2. Receptor Proteins
  3. NKp46/NCR1 Protein, Human (HEK293, mFc)

NKp46/NCR1 protein, a cytotoxicity-activating receptor on natural killer (NK) cells, potentially enhances their efficacy in tumor cell lysis. Interacting with CD247 and FCER1G, NKp46/NCR1 plays a pivotal role in signaling pathways associated with NK cell activation and cytotoxicity. It contributes to the regulatory network for recognizing and eliminating target cells, emphasizing its importance in immune surveillance and anti-tumor responses. NKp46/NCR1 Protein, Human (HEK293, mFc) is the recombinant human-derived NKp46/NCR1 protein, expressed by HEK293 , with C-mFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
20 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time
100 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NKp46/NCR1 protein, a cytotoxicity-activating receptor on natural killer (NK) cells, potentially enhances their efficacy in tumor cell lysis. Interacting with CD247 and FCER1G, NKp46/NCR1 plays a pivotal role in signaling pathways associated with NK cell activation and cytotoxicity. It contributes to the regulatory network for recognizing and eliminating target cells, emphasizing its importance in immune surveillance and anti-tumor responses. NKp46/NCR1 Protein, Human (HEK293, mFc) is the recombinant human-derived NKp46/NCR1 protein, expressed by HEK293 , with C-mFc labeled tag.

Background

The NKp46/NCR1 protein serves as a cytotoxicity-activating receptor, potentially enhancing the efficacy of activated natural killer (NK) cells in mediating the lysis of tumor cells. This receptor interacts with CD247 and FCER1G, playing a pivotal role in the signaling pathways associated with NK cell activation and cytotoxicity against target cells. NKp46/NCR1 contributes to the intricate regulatory network involved in the recognition and elimination of target cells by activated NK cells, highlighting its importance in immune surveillance and anti-tumor responses.

Species

Human

Source

HEK293

Tag

C-mFc

Accession

O76036-1 (Q22-N255)

Gene ID
Molecular Construction
N-term
NKp46 (Q22-N255)
Accession # O76036-1
mFc
C-term
Protein Length

Partial

Synonyms
CD335; Ly94; NCR1; NKp46; MAR-1; NKP46FLJ99094
AA Sequence

QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVQFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQN

Predicted Molecular Mass
52.9 kDa
Molecular Weight

Approximately 65-75 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

NKp46/NCR1 Protein, Human (HEK293, mFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

NKp46/NCR1 Protein, Human (HEK293, mFc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NKp46/NCR1 Protein, Human (HEK293, mFc)
Cat. No.:
HY-P78008
Quantity:
MCE Japan Authorized Agent: