Notch 4 Protein, Mouse (HEK293, His)

Notch 4 protein is a receptor for the ligands JAG1, JAG2 and DLL1 and is responsible for coordinating cell fate decisions.Upon ligand activation, NICD forms a transcriptional activator complex with RBPJ/RBPSUH and activates genes in the cleavage site enhancer.Notch 4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Notch 4 protein, expressed by HEK293 , with C-His labeled tag.

Notch 4 protein serves as a receptor for membrane-bound ligands, including Jagged1, Jagged2, and Delta1, thereby orchestrating cell-fate determination. Following ligand activation, the released notch intracellular domain (NICD) forms a transcriptional activator complex with RBPJ/RBPSUH, instigating the activation of genes within the enhancer of split locus. This versatile protein influences cellular differentiation, proliferation, and apoptotic programs, potentially playing a role in regulating branching morphogenesis during vascular system development. Structurally, it exists as a heterodimer comprising a C-terminal fragment (N(TM)) and a N-terminal fragment (N(EC)), likely connected by disulfide bonds. Notch 4 interacts with transcriptional coactivators MAML1, MAML2, and MAML3, which further modulate downstream transcriptional processes.

Mouse

HEK293

C-8*His

P31695 (E1042-L1441)

18132  [NCBI]

Partial

EMDLCQSQPCSNGGSCEITTGPPPGFTCHCPKGFEGPTCSHKALSCGIHHCHNGGLCLPSPKPGSPPLCACLSGFGGPDCLTPPAPPGCGPPSPCLHNGTCTETPGLGNPGFQCTCPPDSPGPRCQRPGASGCEGRGGDGTCDAGCSGPGGDWDGGDCSLGVPDPWKGCPPHSQCWLLFRDGRCHPQCDSEECLFDGYDCEIPLTCIPAYDQYCRDHFHNGHCEKGCNNAECGWDGGDCRPEGEDSEGRPSLALLVVLRPPALDQQLLALARVLSLTLRVGLWVRKDSEGRNMVFPYPGTRAKEELSGARDSSSWERQAPPTQPLGKETESLGAGFVVVMGVDLSRCGPEHPASRCPWDSGLLLRFLAAMAAVGALEPLLPGPLLAAHPQAGTRPSANQL

50-60 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PB, 500 mM NaCl, 10% glycerol, pH 7.0.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.