Copy Link Print Information

Notch 4 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

Notch 4 protein is a receptor for the ligands JAG1, JAG2 and DLL1 and is responsible for coordinating cell fate decisions.Upon ligand activation, NICD forms a transcriptional activator complex with RBPJ/RBPSUH and activates genes in the cleavage site enhancer.Notch 4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Notch 4 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Notch 4 Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Notch 4 protein is a receptor for the ligands JAG1, JAG2 and DLL1 and is responsible for coordinating cell fate decisions.Upon ligand activation, NICD forms a transcriptional activator complex with RBPJ/RBPSUH and activates genes in the cleavage site enhancer.Notch 4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Notch 4 protein, expressed by HEK293 , with C-His labeled tag.

Background

Notch 4 protein serves as a receptor for membrane-bound ligands, including Jagged1, Jagged2, and Delta1, thereby orchestrating cell-fate determination. Following ligand activation, the released notch intracellular domain (NICD) forms a transcriptional activator complex with RBPJ/RBPSUH, instigating the activation of genes within the enhancer of split locus. This versatile protein influences cellular differentiation, proliferation, and apoptotic programs, potentially playing a role in regulating branching morphogenesis during vascular system development. Structurally, it exists as a heterodimer comprising a C-terminal fragment (N(TM)) and a N-terminal fragment (N(EC)), likely connected by disulfide bonds. Notch 4 interacts with transcriptional coactivators MAML1, MAML2, and MAML3, which further modulate downstream transcriptional processes.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-8*His
  • Accession

    P31695 (E1042-L1441)

  • Gene ID
    18132  [NCBI]
  • Molecular Construction
    • N-term
    • Notch 4 (E1042-L1441)
      Accession # P31695
    • 8*His
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    NOTCH4; Notch (Drosophila) Homolog 4; Prev. INT3; Notch Homolog 4; Neurogenic Locus Notch Homolog Protein 4; NOTCH4 Protein; Notch 4; HNotch4; Notch Receptor 4; Notch Homolog 4 (Drosophila)

  • AA Sequence

    EMDLCQSQPCSNGGSCEITTGPPPGFTCHCPKGFEGPTCSHKALSCGIHHCHNGGLCLPSPKPGSPPLCACLSGFGGPDCLTPPAPPGCGPPSPCLHNGTCTETPGLGNPGFQCTCPPDSPGPRCQRPGASGCEGRGGDGTCDAGCSGPGGDWDGGDCSLGVPDPWKGCPPHSQCWLLFRDGRCHPQCDSEECLFDGYDCEIPLTCIPAYDQYCRDHFHNGHCEKGCNNAECGWDGGDCRPEGEDSEGRPSLALLVVLRPPALDQQLLALARVLSLTLRVGLWVRKDSEGRNMVFPYPGTRAKEELSGARDSSSWERQAPPTQPLGKETESLGAGFVVVMGVDLSRCGPEHPASRCPWDSGLLLRFLAAMAAVGALEPLLPGPLLAAHPQAGTRPSANQL

  • Predicted Molecular Mass

    42.9 kDa

  • Molecular Weight

    Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PB, 500 mM NaCl, 10% glycerol, pH 7.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Notch 4 Protein, Mouse (HEK293, His) Product Image
    1/16
  • Notch 4 Protein, Mouse (HEK293, His) Product Image