1. Recombinant Proteins
  2. Receptor Proteins
  3. Notch family
  4. NOTCH2NL Protein, Human (HEK293, Fc)

NOTCH2NL is a human-specific protein that promotes neural progenitor cell proliferation through Notch signaling regulation, thereby crucially driving the evolutionary expansion of the neocortex. By enhancing self-renewal and downregulating neuronal differentiation genes, NOTCH2NL delays progenitor cell maturation and promotes increased neuronal production. NOTCH2NL Protein, Human (HEK293, Fc) is the recombinant human-derived NOTCH2NL protein, expressed by HEK293 , with N-mFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NOTCH2NL is a human-specific protein that promotes neural progenitor cell proliferation through Notch signaling regulation, thereby crucially driving the evolutionary expansion of the neocortex. By enhancing self-renewal and downregulating neuronal differentiation genes, NOTCH2NL delays progenitor cell maturation and promotes increased neuronal production. NOTCH2NL Protein, Human (HEK293, Fc) is the recombinant human-derived NOTCH2NL protein, expressed by HEK293 , with N-mFc labeled tag.

Background

NOTCH2NL, a human-specific protein, plays a pivotal role in the evolutionary expansion of the neocortex by orchestrating neural progenitor proliferation through modulation of the Notch signaling pathway. By promoting self-renewal of neural progenitors, NOTCH2NL potentially down-regulates genes associated with neuronal differentiation, thereby delaying the maturation of neuronal progenitors and ultimately fostering increased neuronal production. Its influence on the Notch signaling pathway occurs through two parallel mechanisms: firstly, via direct interaction with NOTCH2, enhancing Notch signaling in a non-cell-autonomous manner; and secondly, by autonomously inhibiting cis DLL1-NOTCH2 interactions, thereby promoting sustained neural progenitor status and inhibiting premature neuronal differentiation. These intricate interactions contribute to the unique regulatory role of NOTCH2NL in shaping the complex dynamics of human neurogenesis. Additionally, NOTCH2NL forms direct interactions with ELANE and DLL1, further highlighting its multifaceted involvement in cellular processes.

Species

Human

Source

HEK293

Tag

N-mFc

Accession

Q7Z3S9 (M1-N236)

Gene ID
Molecular Construction
N-term
mFc
NOTCH2NL (M1-N236)
Accession # Q7Z3S9
C-term
Protein Length

Full Length

Synonyms
Notch homolog 2 N-terminal-like protein A; NOTCH2NLA; N2N
AA Sequence

MCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGTCLNLPGSYQCQCLQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGKEHDEN

Molecular Weight

Approximately 55-75 kDa.

Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

NOTCH2NL Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

NOTCH2NL Protein, Human (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NOTCH2NL Protein, Human (HEK293, Fc)
Cat. No.:
HY-P77107
Quantity:
MCE Japan Authorized Agent: