NOTCH2NL Protein, Human (HEK293, Fc)
Based on 1 Customer Validation
NOTCH2NL is a human-specific protein that promotes neural progenitor cell proliferation through Notch signaling regulation, thereby crucially driving the evolutionary expansion of the neocortex. By enhancing self-renewal and downregulating neuronal differentiation genes, NOTCH2NL delays progenitor cell maturation and promotes increased neuronal production. NOTCH2NL Protein, Human (HEK293, Fc) is the recombinant human-derived NOTCH2NL protein, expressed by HEK293 , with N-mFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
NOTCH2NL is a human-specific protein that promotes neural progenitor cell proliferation through Notch signaling regulation, thereby crucially driving the evolutionary expansion of the neocortex. By enhancing self-renewal and downregulating neuronal differentiation genes, NOTCH2NL delays progenitor cell maturation and promotes increased neuronal production. NOTCH2NL Protein, Human (HEK293, Fc) is the recombinant human-derived NOTCH2NL protein, expressed by HEK293 , with N-mFc labeled tag.
Background
NOTCH2NL, a human-specific protein, plays a pivotal role in the evolutionary expansion of the neocortex by orchestrating neural progenitor proliferation through modulation of the Notch signaling pathway. By promoting self-renewal of neural progenitors, NOTCH2NL potentially down-regulates genes associated with neuronal differentiation, thereby delaying the maturation of neuronal progenitors and ultimately fostering increased neuronal production. Its influence on the Notch signaling pathway occurs through two parallel mechanisms: firstly, via direct interaction with NOTCH2, enhancing Notch signaling in a non-cell-autonomous manner; and secondly, by autonomously inhibiting cis DLL1-NOTCH2 interactions, thereby promoting sustained neural progenitor status and inhibiting premature neuronal differentiation. These intricate interactions contribute to the unique regulatory role of NOTCH2NL in shaping the complex dynamics of human neurogenesis. Additionally, NOTCH2NL forms direct interactions with ELANE and DLL1, further highlighting its multifaceted involvement in cellular processes.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-mFc
-
Accession
Q7Z3S9 (M1-N236)
-
Molecular Construction
-
N-term
-
mFc
-
NOTCH2NL (M1-N236)
Accession # Q7Z3S9 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
NOTCH2NLA; Notch Homolog 2 (Drosophila) N-Terminal Like; Prev. NOTCH2NL; Notch Homolog 2 N-Terminal-Like Protein; N2N; Notch 2 N-Terminal Like; Notch Homolog 2 N-Terminal-Like Protein A; Notch 2 N-Terminal Like A; Notch Homolog 2 N-Terminal Like Protein
-
AA Sequence
MCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGTCLNLPGSYQCQCLQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGKEHDEN
-
Molecular Weight
Approximately 55-75 kDa.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
