1. Recombinant Proteins
  2. Others
  3. NOV/CCN3 Protein, Human (sf9, His)

NOV/CCN3 proteins perform a wide range of functions, including proliferation, adhesion, migration, differentiation, and survival. It interacts with various proteins, such as integrins and membrane receptors, affecting different cellular responses. NOV/CCN3 Protein, Human (sf9, His) is the recombinant human-derived NOV/CCN3 protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NOV/CCN3 proteins perform a wide range of functions, including proliferation, adhesion, migration, differentiation, and survival. It interacts with various proteins, such as integrins and membrane receptors, affecting different cellular responses. NOV/CCN3 Protein, Human (sf9, His) is the recombinant human-derived NOV/CCN3 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

NOV/CCN3 protein, an immediate-early participant in cellular processes, orchestrates a wide array of functions, including proliferation, adhesion, migration, differentiation, and survival. This multifaceted role is underscored by its interactions with integrins and membrane receptors, such as NOTCH1, influencing diverse cellular responses. As an essential regulator of hematopoietic stem and progenitor cell function, NOV/CCN3 inhibits myogenic differentiation through the activation of the Notch-signaling pathway. It also exerts inhibitory effects on vascular smooth muscle cells proliferation independently of TGFB1 signaling, showcasing its regulatory influence on cell-cycle regulators. Functioning as a ligand for integrins ITGAV:ITGB3 and ITGA5:ITGB1, NOV/CCN3 directly stimulates pro-angiogenic activities, induces angiogenesis, and promotes endothelial cell adhesion, migration, and survival. Additionally, it plays a role in cutaneous wound healing, supports skin fibroblast adhesion and chemotaxis, and enhances bFGF-induced DNA synthesis in fibroblasts. In bone regeneration, NOV/CCN3 acts as a negative regulator, influencing the articular chondrocytic phenotype while repressing endochondral ossification. It also impacts pancreatic beta-cell function by inhibiting proliferation and insulin secretion. Notably, NOV/CCN3 acts as a negative regulator of endothelial pro-inflammatory activation, attenuates inflammatory pain, and interacts with various proteins, including FBLN1, NOTCH1, GJA1/CX43, ITGA5:ITGB1, ITGAV:ITGB3, ITGAV:ITGB5, and ZDHHC22. These intricate interactions highlight NOV/CCN3's central role in orchestrating diverse cellular functions and regulatory pathways.

Biological Activity

Measured by its ability to mediate Balb/3T3 mouse embryonic fibroblast cell adhesion, rhNOV, immobilized at 10 µg/mL, will induce 48.35 % adhesion on Balbc/3T3 cells (100 µL/well at 3 x 104cells/mL).

Species

Human

Source

Sf9 insect cells

Tag

C-His

Accession

P48745/NP_002505.1 (T32-M357)

Gene ID

4856

Molecular Construction
N-term
CCN3 (T32-M357)
Accession # P48745/NP_002505.1
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuNephroblastoma Overexpressed Gene Protein; IBP-9; CCN3; IGFBP9; NOVH
AA Sequence

TQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM

Molecular Weight

approximately 47 kDa

Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris, 100 mM NaCl, 0.5 mM PMSF, 10 mM Imidazole, 10% glycerol, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

NOV/CCN3 Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

NOV/CCN3 Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NOV/CCN3 Protein, Human (sf9, His)
Cat. No.:
HY-P701327
Quantity:
MCE Japan Authorized Agent: