NOV/CCN3 Protein, Human (sf9, His)

Customer Review

Based on 1 Customer Validation

NOV/CCN3 proteins perform a wide range of functions, including proliferation, adhesion, migration, differentiation, and survival. It interacts with various proteins, such as integrins and membrane receptors, affecting different cellular responses. NOV/CCN3 Protein, Human (sf9, His) is the recombinant human-derived NOV/CCN3 protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

NOV/CCN3 proteins perform a wide range of functions, including proliferation, adhesion, migration, differentiation, and survival. It interacts with various proteins, such as integrins and membrane receptors, affecting different cellular responses. NOV/CCN3 Protein, Human (sf9, His) is the recombinant human-derived NOV/CCN3 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

NOV/CCN3 protein, an immediate-early participant in cellular processes, orchestrates a wide array of functions, including proliferation, adhesion, migration, differentiation, and survival. This multifaceted role is underscored by its interactions with integrins and membrane receptors, such as NOTCH1, influencing diverse cellular responses. As an essential regulator of hematopoietic stem and progenitor cell function, NOV/CCN3 inhibits myogenic differentiation through the activation of the Notch-signaling pathway. It also exerts inhibitory effects on vascular smooth muscle cells proliferation independently of TGFB1 signaling, showcasing its regulatory influence on cell-cycle regulators. Functioning as a ligand for integrins ITGAV:ITGB3 and ITGA5:ITGB1, NOV/CCN3 directly stimulates pro-angiogenic activities, induces angiogenesis, and promotes endothelial cell adhesion, migration, and survival. Additionally, it plays a role in cutaneous wound healing, supports skin fibroblast adhesion and chemotaxis, and enhances bFGF-induced DNA synthesis in fibroblasts. In bone regeneration, NOV/CCN3 acts as a negative regulator, influencing the articular chondrocytic phenotype while repressing endochondral ossification. It also impacts pancreatic beta-cell function by inhibiting proliferation and insulin secretion. Notably, NOV/CCN3 acts as a negative regulator of endothelial pro-inflammatory activation, attenuates inflammatory pain, and interacts with various proteins, including FBLN1, NOTCH1, GJA1/CX43, ITGA5:ITGB1, ITGAV:ITGB3, ITGAV:ITGB5, and ZDHHC22. These intricate interactions highlight NOV/CCN3's central role in orchestrating diverse cellular functions and regulatory pathways.

Verified Bioactivity

Measured by its ability to mediate Balb/3T3 mouse embryonic fibroblast cell adhesion, rhNOV, immobilized at 10 µg/mL, will induce 48.35 % adhesion on Balbc/3T3 cells (100 µL/well at 3 x 104cells/mL).

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CCN3 (T32-M357)
      Accession # P48745/NP_002505.1
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CCN3; Protein NOV Homolog; Prev. NOV; IBP-9; IGFBP9; Nephroblastoma-Overexpressed Gene Protein Homolog; Nephro Blastoma-Overexpressed Gene Protein Homolog; Nephroblastoma Overexpressed Gene; Insulin-Like Growth Factor-Binding Protein 9; NOVh; Nephroblasto

  • AA Sequence

    TQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM

  • Predicted Molecular Mass

    37 kDa

  • Molecular Weight

    Approximately 47 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris, 100 mM NaCl, 0.5 mM PMSF, 10 mM Imidazole, 10% glycerol, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00