NPR1/NPRA Protein, Rat (HEK293, His)

NPR1/NPRA Protein, Rat (HEK293, His) is the recombinant rat-derived NPR1/NPRA protein, expressed by HEK293, with C-His tag.

NPR1/NPRA is a receptor for the atrial natriuretic peptide NPPA/ANP and the brain natriuretic peptide NPPB/BNP, which are potent vasoactive hormones playing a key role in cardiovascular homeostasis. It plays an essential role in regulating endothelial cell senescence and vascular aging. Upon activation by ANP or BNP, NPR1/NPRA stimulates the production of cyclic guanosine monophosphate (cGMP), which promotes vascular tone and volume homeostasis by activating protein kinase cGMP-dependent 1/PRKG1 and subsequently PRKAA1, thereby controlling blood pressure and maintaining cardiovascular homeostasis.

Rat

HEK293

C-8*His

NP_036745 (S29-E469)

24603

Partial

SDLTVAVVLPLTNTSYPWSWARVGPAVELALARVKARPDLLPGWTVRMVLGSSENAAGVCSDTAAPLAAVDLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLTAGAPALGIGVKDEYALTTRTGPSHVKLGDFVTALHRRLGWEHQALVLYADRLGDDRPCFFIVEGLYMRVRERLNITVNHQEFVEGDPDHYPKLLRAVRRKGRVIYICSSPDAFRNLMLLALNAGLTGEDYVFFHLDVFGQSLKSAQGLVPQKPWERGDGQDRSARQAFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTVEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNYNGTSQELMAVSEHKLYWPLGYPPPDVPKCGFDNEDPACNQDHFSTLE

Approximately 60-75 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.