NR3C1 Protein, Human (His)

NR3C1 Protein, Human (His) is the recombinant human-derived NR3C1, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

NR3C1 Protein, Human (His) is the recombinant human-derived NR3C1, expressed by E. coli , with C-6*His labeled tag.

Background

The Glucocorticoid Receptor (GR) is a receptor for glucocorticoids (GC) with a dual mode of action: functioning as a transcription factor that binds to glucocorticoid response elements (GRE) in both nuclear and mitochondrial DNA, and as a modulator of other transcription factors. It regulates inflammatory responses, cellular proliferation, and differentiation, and is involved in chromatin remodeling. GR also promotes rapid mRNA degradation by binding to target mRNA 5' UTRs and interacting with PNRC2 in a ligand-dependent manner, recruiting UPF1 and DCP1A to induce RNA decay. Additionally, GR acts as a coactivator for STAT5-dependent transcription upon growth hormone (GH) stimulation and plays a critical role in hepatic GR-mediated body growth regulation (by similar). GR exhibits both transcriptional activation and repression activities, mediates glucocorticoid-induced apoptosis, and ensures accurate chromosome segregation during mitosis. It may function as a tumor suppressor and negatively regulate adipogenesis by controlling lipolytic and antilipogenic gene expression (by similar). Different isoforms (e.g., Alpha) display varying functions, including transcriptional activity, hormone-binding capacity, and roles in glucose metabolism regulation.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • NR3C1 (V521-K777)
      Accession # P04150-1
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    NR3C1; Nuclear Receptor Subfamily 3 Group C Member 1 Variant HGR-B(77); Prev. GRL; GCR; GR; Nuclear Receptor Subfamily 3, Group C, Member 1; Glucocorticoid Receptor; Alternative Protein NR3C1; Nuclear Receptor Subfamily 3, Group C, Member 1 (Glucocorticoid Receptor); GCRST; Nuclear Receptor Subfamily 3 Group C Member 1 Variant HGR-B(54); GCCR; Nuclear Receptor Subfamily 3 Group C Member 1; Nuclear Receptor Subfamily 3 Group C Member 1 Variant HGR-B(93)

  • AA Sequence

    VPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK

  • Predicted Molecular Mass

    36.8 kDa

  • Molecular Weight

    Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Endotoxin Level

/

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00