NR3C1 Protein, Human (His)
NR3C1 Protein, Human (His) is the recombinant human-derived NR3C1, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
NR3C1 Protein, Human (His) is the recombinant human-derived NR3C1, expressed by E. coli , with C-6*His labeled tag.
Background
The Glucocorticoid Receptor (GR) is a receptor for glucocorticoids (GC) with a dual mode of action: functioning as a transcription factor that binds to glucocorticoid response elements (GRE) in both nuclear and mitochondrial DNA, and as a modulator of other transcription factors. It regulates inflammatory responses, cellular proliferation, and differentiation, and is involved in chromatin remodeling. GR also promotes rapid mRNA degradation by binding to target mRNA 5' UTRs and interacting with PNRC2 in a ligand-dependent manner, recruiting UPF1 and DCP1A to induce RNA decay. Additionally, GR acts as a coactivator for STAT5-dependent transcription upon growth hormone (GH) stimulation and plays a critical role in hepatic GR-mediated body growth regulation (by similar). GR exhibits both transcriptional activation and repression activities, mediates glucocorticoid-induced apoptosis, and ensures accurate chromosome segregation during mitosis. It may function as a tumor suppressor and negatively regulate adipogenesis by controlling lipolytic and antilipogenic gene expression (by similar). Different isoforms (e.g., Alpha) display varying functions, including transcriptional activity, hormone-binding capacity, and roles in glucose metabolism regulation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P04150-1 (V521-K777)
-
Gene ID2908
-
Molecular Construction
-
N-term
-
NR3C1 (V521-K777)
Accession # P04150-1 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
NR3C1; Nuclear Receptor Subfamily 3 Group C Member 1 Variant HGR-B(77); Prev. GRL; GCR; GR; Nuclear Receptor Subfamily 3, Group C, Member 1; Glucocorticoid Receptor; Alternative Protein NR3C1; Nuclear Receptor Subfamily 3, Group C, Member 1 (Glucocorticoid Receptor); GCRST; Nuclear Receptor Subfamily 3 Group C Member 1 Variant HGR-B(54); GCCR; Nuclear Receptor Subfamily 3 Group C Member 1; Nuclear Receptor Subfamily 3 Group C Member 1 Variant HGR-B(93)
-
AA Sequence
VPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK
-
Predicted Molecular Mass
36.8 kDa
-
Molecular Weight
Approximately 35 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
/
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)