NTCP Protein, Human (HEK293)
Based on 1 Customer Validation
NTCP Protein, Human (HEK293) is the recombinant human-derived NTCP, expressed by HEK293.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
NTCP Protein, Human (HEK293) is the recombinant human-derived NTCP, expressed by HEK293.
Background
NTCP is a major transporter of conjugated bile salts from plasma into hepatocytes, playing a key role in the enterohepatic circulation of bile salts, which are essential for the solubilization and absorption of dietary fat and fat-soluble vitamins. Its function is strictly dependent on the extracellular presence of sodium. NTCP exhibits broad substrate specificity, transporting various bile acids (e.g., taurocholate, cholate) as well as non-bile acid organic compounds (e.g., estrone sulfate). It works collaboratively with the ileal transporter (NTCP2), the organic solute transporter (OST), and the bile salt export pump (BSEP) to ensure efficient biological recycling of bile acids during enterohepatic circulation. by similar: Its function is strictly dependent on the extracellular presence of sodium; it works collaboratively with the ileal transporter (NTCP2), the organic solute transporter (OST), and the bile salt export pump (BSEP).
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
Q14973 (M1-A349)
-
Gene ID6554
-
Protein Length
Full Length
-
Synonyms
SLC10A1; NTCP1; Solute Carrier Family 10 Member 1; Solute Carrier Family 10 (Sodium/Bile Acid Cotransporter Family), Member 1; NTCP; Na+/Taurocholate Cotransporting Polypeptide; Sodium/Taurocholate Cotransporting Polypeptide; Na/Taurocholate Cotransportin
-
AA Sequence
MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLLIAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA
-
Predicted Molecular Mass
38.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM HEPES , pH 7.5, 150 mM NaCl, 0.005% (w/v) LMNG.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)