OARD1 Protein, Human (Myc, His)

OARD1 is an ADP:ATP antiporter that regulates mitochondrial energy dynamics by shuttling ADP for ATP synthesis and exporting ATP. It induces mitochondrial thermogenesis, uncouples proton flux and regulates ATP production efficiency. OARD1 Protein, Human (Myc, His) is the recombinant human-derived OARD1 protein, expressed by E. coli , with N-His, C-Myc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

OARD1 is an ADP:ATP antiporter that regulates mitochondrial energy dynamics by shuttling ADP for ATP synthesis and exporting ATP. It induces mitochondrial thermogenesis, uncouples proton flux and regulates ATP production efficiency. OARD1 Protein, Human (Myc, His) is the recombinant human-derived OARD1 protein, expressed by E. coli , with N-His, C-Myc labeled tag.

Background

SLC25A5, an ADP:ATP antiporter, serves as a crucial mediator of mitochondrial energy dynamics, shuttling ADP into the mitochondrial matrix for ATP synthesis while exporting ATP to support cellular functions. Operating through the alternating access mechanism, it transitions between the cytoplasmic-open state (c-state) and the matrix-open state (m-state) at the inner mitochondrial membrane. Beyond its antiporter role, SLC25A5 contributes to mitochondrial uncoupling and mitochondrial permeability transition pore (mPTP) activity. Acting as a proton transporter, it induces mitochondrial thermogenesis by uncoupling proton flows via the electron transport chain and ATP synthase, thereby modulating ATP production efficiency. This proton transporter activity is finely regulated by the antiporter function, highlighting SLC25A5's role as a master regulator balancing ATP production and thermogenesis. SLC25A5's proton transport is facilitated by free fatty acids, acting as cofactors, without transporting them. Additionally, SLC25A5 plays a role in mitophagy regulation, independently of its antiporter activity, by promoting mitophagy through interaction with TIMM44 and inhibiting the presequence translocase TIMM23, leading to PINK1 stabilization. It is also implicated in chromosome segregation as part of the mitotic spindle-associated MMXD complex. Furthermore, SLC25A5 is involved in mPTP opening, contributing to cellular processes such as cell death, although its exact role in pore formation remains unclear.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His;C-Myc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His
    • OARD1 (A2-L152)
      Accession # Q9Y530
    • Myc
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    OARD1; ADP-Ribose Glycohydrolase OARD1; Prev. C6orf130; MGC19570; Terminal ADP-Ribose Protein Glycohydrolase 1; Chromosome 6 Open Reading Frame 130, Isoform CRA_a; TARG1; O-Acetyl-ADP-Ribose Deacetylase C6orf130; [Protein ADP-Ribosylglutamate] Hydrolase O

  • AA Sequence

    ASSLNEDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLNQQKKSGEVAVLKRDGRYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAMIEEVFEATDIKITVYTL

  • Predicted Molecular Mass

    24.3 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00